DictionaryForumContacts

Terms containing principles | all forms | exact matches only
SubjectEnglishGerman
gen.a man of principleein Mann mit Prinzipien
gen.ability to pay principleGrundsatz der steuerlichen Leistungsfähigkeit
tech.absorption silencing principleAbsorptionsdämpfungsprinzip
gen.acceleration principleAkzelerationsprinzip
econ.accepted principles of moralitygute Sitten
gen.according to the technical principles of life assurancenach Art der Lebensversicherung
busin., ITaccounting principlesGrundsätze ordnungsmäßiger Buchführung (und Bilanzierung)
econ.accounting principles and conventions of the ESAVerbuchungsgrundsätze und-vereinbarungen des ESVG
gen.achievement principleLeistungsprinzip
immigr.act contrary to the purpose and principles of the UNHandlung im Widerspruch zu den Zielen und Grundsätzen der Vereinten Nationen
nucl.phys.Action Plan for the Implementation of the Basic Principles for an EU Strategy against Proliferation of Weapons of Mass DestructionAktionsplan für die Umsetzung der Grundprinzipien einer Strategie der EU gegen die Verbreitung von Massenvernichtungswaffen
gen.Action Plan for the Implementation of the Basic Principles for an EU Strategy against Proliferation of Weapons of Mass DestructionAktionsplan zur Nichtverbreitung von Massenvernichtungswaffen
gen.Action Plan for the Implementation of the Basic Principles for an EU Strategy against Proliferation of Weapons of Mass DestructionAktionsplan von Thessaloniki
emerg.careactive principleWirkstoff
gen.active principleWirkprinzip
tech.Adcock antenna principleAdcock-Peilverfahren
gen.administering of the principleHandhabung des Prinzips
gen.agree in principlegrundsätzlich zustimmen
gen.Agreed Principles for the Rafah CrossingEinvernehmliche Grundsätze für den Grenzübergang Rafah
gen.agreement on the principle of the enlargement of the CommunityUebereinstimmung hinsichtlich des Grundsatzes der Erweiterung der Gemeinschaft
gen.AIDA principle attention, interest, desire, actionAIDA-Prinzip
gen.air leakage principleLuftaustrittsprinzip
med.all-or-none principleAlles-oder-Nichts-Prinzip
med.all-or-none principleAlles-oder-Nichts-Gesetz
gen.to allow for derogation from the general principleein Abweichen von dem allgemeinen Grundsatz ermöglichen
gen.alphabetical principle of arrangementalphabetisches Ordnungssystem
IMF.AML supervisory principlesAufsichtsgrundsätze für die Bekämpfung der Geldwäsche
gen.anthropic principleanthropisches Prinzip
med.antipernicious principleAntiperniziosaprinzip
gen.application of ergonomic principles for remedyFörderung der korrektiven Ergonomie
tech., construct.application of the principles of normalization and modular coordinationAnwendung der Normung und der Koordinierung der Module
lawapproval principlesZulassungsgrundsätze
gen.Archimedes' principlearchimedisches Prinzip
gen.arm's length principleGrundsatz des Fremdvergleichs
gen.as a basic principlegrundsätzlich
gen.as a matter of principleprinzipiell
gen.as a matter of principleaus prinzipiellen Gründen
gen.as a matter of principleaus Prinzip
gen.as a matter of principleim Prinzip
gen.attack the very principle of private propertydas Prinzip des Privateigentums schlechthin anfechten
tax.audit principlesPrüfungsgrundsätze
tech.automatic null-balancing potentiometer principlePotentiometer-Schreibprinzip
med.base principleGrundprinzip
IMF.Basel Core PrinciplesLeitlinien für eine wirksame Bankenaufsicht
IMF.Basel Core PrinciplesKerngrundsätze für eine wirksame Bankenaufsicht
econ., fin.Basel core principlesGrundsätze für eine wirksame Bankenaufsicht
crim.law., law, int. law.basic principlesGrundsätzen
tech.basic principlesBasiswissen
telecom.basic principles of operationgrundsätzliche Arbeitsweise
telecom.basic principles of operationArbeitsweise
gen.Basic Principles on the Independence of the JudiciaryGrundprinzipien der Unabhängigkeit der Richterschaft
gen.Basic Principles on the Independence of the JudiciaryGrundprinzipien der Unabhängigkeit der Richter
law, crim.law., h.rghts.act.Basic Principles on the Use of Force and Firearms by Law Enforcement OfficialsGrundprinzipien für die Anwendung von Gewalt und den Gebrauch von Schusswaffen durch Beamte mit Polizeibefugnissen
crim.law., UNBasic principles on the use of restorative justice programmes in criminal mattersGrundprinzipien für den Einsatz der ausgleichsorientierten Justiz in Strafsachen
patents.to be contrary to accepted principles of moralitygegen die guten Sitten verstossen
f.trade.be contrary to fundamental principlesGrundsätzen zuwiderlaufen
h.rghts.act., UNBody of Principles for the Protection of all Persons under any Form of Detention or ImprisonmentGrundsatzkatalog für den Schutz aller irgendeiner Form von Haft oder Strafgefangenschaft unterworfenen Personen
tech.Bohr's correspondence principleBohr'sches-Korrespondenzprinzip
tech.Bohr's correspondence principleBohr'sches-Auswaehlprinzip
tech.Bohr's selection principleBohr'sches-Auswaehlprinzip
dosim.Bragg-Gray principleBragg-Graysche Beziehung
dosim.Bragg-Gray principleBragg-Graysches Prinzip
gen.Bragg-Gray principleHohlraumprinzip
gen.Bragg-Gray principleBragg-Gray Prinzip
comp.building block principleBausteinprinzip
busin.business principlesbetriebswirtschaftliche Grundsätze
environ.Cairo Guidelines and Principles for the Environmentally Sound Management of Hazardous WastesKairoer Richtlinien und Grundsätze für die umweltgerechte Behandlung gefährlicher Abfälle
IMF.Code of Good Practices on Transparency in Monetary and Financial Policies: Declaration of PrinciplesVerfahrenskodex zur Transparenz der Geld- und Finanzpolitik
food.ind.code of principlesGrundsatzbestimmungen (F.A.O.)
construct.code of principles, code of professional conductRegeln für die Berufsausübung
f.trade.collaboration in accordance with common principles and rulesZusammenarbeit nach gemeinsamen Grundsätzen und Regeln
gen.collegial principleKollegialprinzip
tax.commensurate with the principles of orderly accountingden Grundsätzen ordnungsmäßiger Buchführung entsprechen
tax.commensurate with the principles of orderly accountingden Grundsätzen ordnungsgemäßer Buchführung entsprechen
bank.commercial principlesGrundsätze ordnungsgemässer Buchführung
bank.commercial principleskaufmännische Grundsätze
environ.Commission Directive 93/67/EEC of 20 July 1993 laying down the principles for assessment of risks to man and the environment of substances notified in accordance with Council Directive 67/548/EECRichtlinie 93/67/EWG der Kommission vom 20. Juli 1993 zur Festlegung von Grundsätzen für die Bewertung der Risiken für Mensch und Umwelt von gemäß der Richtlinie 67/548/EWG des Rates notifizierten Stoffen
environ.Commission Regulation EC No 1488/94 of 28 June 1994 laying down the principles for the assessment of risks to man and the environment of existing substances in accordance with Council Regulation EEC No 793/93 Text with EEA relevanceVerordnung EG Nr. 1488/94 der Kommission vom 28. Juni 1994 zur Festlegung von Grundsaetzen für die Bewertung der von Altstoffen ausgehenden Risiken für Mensch und Umwelt gemaess der Verordnung EWG Nr. 793/93 des Rates
immigr.Common Basic PrinciplesGemeinsame Grundprinzipien
immigr.Common Basic PrinciplesGGP
immigr.Common Basic PrinciplesGemeinsame Grundprinzipien für die Integration
immigr.Common basic principles for immigrant integration policy in the European UnionGemeinsame Grundprinzipien für die Integration
immigr.Common basic principles for immigrant integration policy in the European UnionGGP
law, commer., polit.Common Understanding on the principles of international cooperation in research and development activities in the domain of Intelligent Manufacturing Systems between the European Community and the United States of America, Japan, Australia, Canada and the EFTA countries of Norway and SwitzerlandVerständigung über die Grundsätze der internationalen Zusammenarbeit bei Forschung und Entwicklung im Bereich der intelligenten Fertigungssysteme zwischen der Europäischen Gemeinschaft und den Vereinigten Staaten von Amerika, Japan, Australien, Kanada und den EFTA-Ländern Norwegen und der Schweiz
comp.competition principleKonkurrenzprinzip
med.competitive exclusion principleKonkurrenz-Ausschluss-Prinzip
biol.competitive exclusion principleExklusionsprinzip
tax.conform with proper accounting principlesden Grundsätzen ordnungsgemäßer Buchführung entsprechen
gen.contravene a principleeinem Grundsatz widersprechen
social.sc., empl., UNConvention concerning the Application of the Principles of the Right to Organise and to Bargain CollectivelyÜbereinkommen über die Anwendung der Grundsätze des Vereinigungsrechtes und des Rechtes zu Kollektivverhandlungen
gen.Convention for the Adaptation of the Principles of the Geneva Convention to Maritime WarAbkommen betreffend die Anwendung der Grundsätze der Genfer Konvention vom 22. August 1864 auf den Seekrieg
IMF.core principlesLeitlinien für eine wirksame Bankenaufsicht
IMF.core principlesKerngrundsätze für eine wirksame Bankenaufsicht
econ., fin.core principlesGrundsätze für eine wirksame Bankenaufsicht
IMF.Core Principles for Effective Banking Supervision BIS, Basle CommitteeLeitlinien für eine wirksame Bankenaufsicht
IMF.Core Principles for Effective Banking Supervision BIS, Basle CommitteeKerngrundsätze für eine wirksame Bankenaufsicht
econ., fin.core principles for effective banking supervisionGrundsätze für eine wirksame Bankenaufsicht
IMF.Core Principles for Systemically Important Payment SystemsGrundprinzipien für Zahlungsverkehrssysteme, die für die Stabilität des Finanzsystems bedeutsam sind
IMF.Core Principles for Systemically Important Payment SystemsGrundprinzipien für wichtige Zahlungsverkehrssysteme
tech.correspondence principleKorrespondenzprinzip (von Bohr)
tech.correspondence principleKorrespondenzusus
tech.correspondence principleKorrespondenzgewohnheit
gen.cost-of-service principleÄquivalenzprinzip
gen.costs-by-cause principleVerursacherprinzip
econ.Council Decision on the principles, priorities, intermediate objectives and conditions contained in the accession partnership with...Beschluß des Rates über die Grundsätze,Prioritäten,Zwischenziele und Bedingungen der Beitrittspartnerschaft mit...
econ.Council Decision...on the principles, priorities, intermediate objectives and conditions contained in the Accession Partnership with...Beschluss des Rates...über die Grundsätze, Prioritäten, Zwischenziele und Bedingungen der Beitrittspartnerschaft mit...
gen.Council Framework Decision on the application of the principle of mutual recognition to confiscation ordersRahmenbeschluss über die gegenseitige Anerkennung von Einziehungsentscheidungen
gen.country of origin principle CoOPHerkunftslandsprinzip
econ.credit principlesKreditgrundsätze
gen.D'Alembert's principleD'Alembert'sches Prinzip
gen.data bank organised in accordance with the time series principlenach dem Zeitreihenprinzip organisierte Datenbank
busin., ITdata processing principlesordnungsmäßiger Datenverarbeitung
busin., ITdata protection principlesGrundsätze ordnungsmäßigen Datenschutzes
busin., ITdata protection principlesordnungsmäßigen Datenschutzes
law, h.rghts.act., UNDeclaration of Basic Principles of Justice for Victims of Crime and Abuse of PowerErklärung über Grundprinzipien der rechtmäßigen Behandlung von Verbrechensopfern und Opfern von Machtmissbrauch
environ., nucl.phys.Declaration of Principles Regarding a Multilateral Nuclear Environmental Programme in the Russian FederationGrundsatzerklärung betreffend ein multilaterales Umwelt- und Nuklearprogramm in der Russischen Föderation MNEPR
social.sc.Declaration on Fundamental Principles and Rights at WorkErklärung über die grundlegenden Prinzipien und Rechte bei der Arbeit
social.sc., UNDeclaration on Social and Legal Principles relating to the Protection and Welfare of Children, with Special Reference to Foster Placement and Adoption Nationally and InternationallyErklärung über die sozialen und rechtlichen Grundsätze für den Schutz und das Wohl von Kindern unter besonderer Berücksichtigung der Unterbringung in Pflegestellen und der Adoption auf nationaler und internationaler Ebene
econ., environ.Declaration on the guiding principles for sustainable developmentErklärung über die Leitprinzipien der nachhaltigen Entwicklung
UNDeclaration on the Guiding Principles of Drug Demand ReductionErklärung über die Leitgrundsätze für die Senkung der Drogennachfrage
lawDeclaration relating to the Protocol on the application of the principles of subsidiarity and proportionalityErklärung Nr.43 zum Protokoll über die Anwendung der Grundsätze der Subsidiarität und der Verhältnismässigkeit
tech.degenerative principleGegenkopplungsprinzip (negative feedback)
comp.design principleEntwurfsgrundsatz
tech.design principleBemessungsgrundlage
tech.design principleKonstruktionsprinzip
comp.design principleEntwurfsprinzip
construct.design principlesBemessungsgrundlagen
construct.design principlesBemessungsgrundsätze
construct.design principlesallgemeine Bemessungsregeln
tech.design principlesgrundsaetzlicher Aufbau
med.diabetogenic antehypophyseal principlediabetogenes Hypophysenvorderlappenprinzip
lawdispute about principlesPrinzipienstreit
med.divergence principleDivergenzprinzip
tech.Doppler's principleDopplerprinzip
tech.duality principleDualitaetsprinzip
environ., UNECE principles regarding Cooperation in the Field of Transboundary WatersECE-Grundsätze in bezug auf die Zusammenarbeit auf dem Gebiet grenzüberschreitender Gewässer
tech.Einstein's equivalence principleEinstein'sche Masse-Energie-Aequivalenzprinzip
refrig.equivalence principleerster Hauptsatz der Thermodynamik
tech.equivalence principleMasse-Energie Aequivalenzprinzip
gen.equivalence principleerster Hauptsatz der thermodynamik
mater.sc.ergonomic design principleergonomischer Gestaltungsgrundsatz
health.ergonomic principles for improvementkorrektive Ergonomie
health.ergonomic principles for improvementKorrekturergonomie
f.trade.established principlesfeststehende Grundsätze
immigr.EU common basic principles on integrationGGP
immigr.EU common basic principles on integrationGemeinsame Grundprinzipien für die Integration
environ.European Principles for the EnvironmentUmweltschutzprinzipien der EU
gen.exception to the principle of responsibilityAusnahme vom Grundsatz der Verantwortlichkeit
gen.exception to the principle of responsibilityAusnahme vom Grundsatz der Haftung
med.exclusion principleAusschlußprinzip
econ., busin., labor.org.fair value accounting principlesGrundsätze der Rechnungslegung zum beizulegenden Zeitwert
tech.falling-film principleBerieselungsprinzip
med.Fick principleFick-Prinzip
med.Fick principle of circulatory analysisFick Prinzip
med.Fick principle of circulatory analysisFick Kreislaufanalyse
refrig.first principleerster Hauptsatz der Thermodynamik
refrig.first principle of thermodynamicserster Hauptsatz der Thermodynamik
gen.first principle of thermodynamicserster Hauptsatz der thermodynamik
gen.for the Nine, those principles cannot be dissociatedfuer die Neun sind diese Grundsaetze ein untrennbares Ganzes
med.founder principleGründerprinzip
med.founder principleGründereffekt
gen.four-eye-principleVier-Augen-Prinzip
gen.Framework Agreement between the European Community and Bosnia and Herzegovina on the general principles for the participation of Bosnia and Herzegovina in Community programmesRahmenabkommen zwischen der Europäischen Gemeinschaft und Bosnien und Herzegowina über die allgemeinen Grundsätze der Teilnahme Bosniens und Herzegowinas an Programmen der Gemeinschaft
gen.Framework Agreement between the European Community and Serbia and Montenegro on the general principles for the participation of Serbia and Montenegro in Community programmesRahmenabkommen zwischen der Europäischen Gemeinschaft und Serbien und Montenegro über die allgemeinen Grundsätze der Teilnahme Serbiens und Montenegros an Programmen der Gemeinschaft
gen.Framework Agreement between the European Community and the Republic of Albania on the general principles for the participation of the Republic of Albania in Community programmesRahmenabkommen zwischen der Europäischen Gemeinschaft und der Republik Albanien über die allgemeinen Grundsätze der Teilnahme der Republik Albanien an Programmen der Gemeinschaft
gen.Framework Agreement between the European Community and the Republic of Croatia on the general principles for the participation of the Republic of Croatia in Community programmesRahmenabkommen zwischen der Europäischen Gemeinschaft und der Republik Kroatien über die allgemeinen Grundsätze der Teilnahme der Republik Kroatien an Programmen der Gemeinschaft
EU.fundamental principlesGrundprinzipien
chem.fundamental principlesGrundlage
lawfundamental principles of democratic electionsdie Grundprinzipien demokratischer Wahlen
lawfundamental principles of the electoral systemWahlgrundsätze
gen.general principleLeitvorstellung
gen.general principleLeitbild
gen.general principleallgemeiner Grundsatz
gen.General Principles governing the Payment of InformersAllgemeine Grundsätze für die Entlohung von Informanten/Vertrauenpersonen
gen.general procedural principlesallgemeine Verfahrensgrundsätze
f.trade.general rules and principlesallgemeine Regeln und Grundsätze
fin., account.generally accepted accounting principlesGrundsatz ordnungsmäßiger Buchführung
fin., account.generally accepted accounting principlesGrundsätze ordnungsmäßiger Buchführung
fin., account.generally accepted accounting principlesBilanzierung
fin.generally accepted accounting principlesallgemein anerkannte Rechnungslegungsgrundsätze
econ.generally accepted accounting principlesallgemein anerkannte Grundsätze der Buchführung
amer.Generally Accepted Accounting Principlesallgemein anerkannte Grundsätze der Rechnungslegung (GAAP)
law, ADR, amer.generally accepted accounting principlesGrundsätze ordnungsgemäßer Rechnungslegung (bzw. Bilanzierung)
econ.generally accepted accounting principlesanerkannte Grundsätze der Buchführung (GAAP)
econ.generally accepted accounting principlesoffiziell anerkannte Berechnungsprinzipien
econ.generally accepted accounting principlesallgemein anerkannte Prinzipien der Rechnungsführung
fin., account.generally accepted accounting principlesallgemein anerkannter kaufmännischer Grundsatz
IMF.generally accepted accounting principlesallgemeine Grundsätze ordnungsgemäßer Rechnungslegung und Bilanzierung
IMF.generally accepted accounting principlesallgemein anerkannte Grundsätze der Rechnungslegung
comp., MSGenerally Accepted Accounting PrinciplesUS-amerikanische Rechnungslegungsvorschriften (A widely accepted set of accounting conventions, rules, and standards for United States companies)
fin., account.generally accepted accounting principlesallgemein anerkannte Buchführungsgrundsätze
gen.generally accepted accounting principles GAAPGrundsätze ordnungsmäßiger Buchführung GoB
gen.to give effect to the principles set out in Article RF EEC Treaty 87, ldie Verwirklichung der in Artikel niedergelegten Grundsaetze
law, food.ind.Green Paper on the general principles of food law in the European UnionGrünbuch über die allgemeinen Grundsätze des Lebensmittelrechts in der Europäischen Union
med.grouping principlesGruppierungsprinzip
gen.guidance principleLeitprinzip
gen.guidance principleLeitgrundsatz
gen.guiding principleLeitsatz
gen.guiding principleAnhaltspunkt
gen.guiding principleLeitgedanke
gen.guiding principleOrientierungspunkte
gen.guiding principleRichtpunkt
gen.guiding principleLeitlinien
gen.guiding principleAusrichtung
gen.guiding principleRichtschnur
gen.guiding principleRichtsatz
gen.guiding principleZielvorstellungen
gen.guiding principleLeitgrundsatz
gen.guiding principleRichtung
gen.guiding principleLeitprinzip
EU.guiding principlesrichtungweisende Grundsätze
insur.DAC Guiding Principles for the Use of Aid in Association with Export Credits and other Market Funds OECDLeitprinzipien des Entwicklungshilfeausschusses der OECD für die Verwendung von Hilfe in Verbindung mit Exportkrediten und anderen Kapitalmitteln
gen.guiding principles of the two-year civilian consolidation plan of the peace processLeitprinzipien des zweijährigen Plans zur zivilen Konsolidierung des Friedensprozesses
gen.handicap principleHandicap-Prinzip
gen.hazard generated by neglecting ergonomic principles EN 292Gefährdung durch Vernachlässigung ergonomischer Prinzipien EN 292
gen.Hazard generated by neglecting ergonomics principles (ENGefährdung durch Vernachlässigung ergonomischer Prinzipien (EN 292)
gen.Heisenberg indeterminacy principle less frequentHeisenbergsche Unschärferelation
gen.Heisenberg indeterminacy principle less frequentHeisenbergsche Unbestimmtheitsrelation seltener
gen.Heisenberg uncertainty principleHeisenbergsche Unschärferelation (Physik)
tech.heterodyne principleUeberlagerungsprinzip
gen.home country principleHerkunftslandsprinzip
tech.Huygen's principleHuygen'sches Prinzip
gen.Huygens' principleHuygenssche Prinzip
gen.I agree in principleIch bin prinzipiell einverstanden
social.sc.ILO Declaration on Fundamental Principles and Rights at WorkErklärung über die grundlegenden Prinzipien und Rechte bei der Arbeit
gen.in conformity with animal protection principlestierschutzgerecht
gen.in principleim Prinzip
gen.in principlean sich
gen.in principle, interventions will be made in participating currenciesInterventionen erfolgen grundsaetzlich in Teilnehmerwährungen
lawin so far as this does not conflict with the principlessoweit hierdurch die Grundsaetze nicht beeintraechtigt werden
gen.indeterminacy principleUnbestimmtheitsrelation
gen.indeterminacy principleUnschaerfeprinzip
gen.indeterminacy principleHeisenbergsches Unbestimmtheitsprinzip
tech.inferometer principleInferometer-Prinzip
IMF.Insurance Core PrinciplesVersicherungsgrundsätze
gen.Interdiction Principles for the Proliferation Security InitiativeUnterbindungsgrundsätze der Sicherheitsinitiative
gen.Interdiction Principles for the Proliferation Security InitiativePSI-Unterbindungsgrundsätze
med.isohydric principleisohydrisches Prinzip
tech.iteration principleIterationsverfahren
gen.It's against my principles.Das verstößt gegen meine Prinzipien.
gen.judgement establishing a principleGrundsatzurteil
gen."Keep It Simple, Stupid" principlePrinzip "Halte es möglichst einfach!"
gen.KISS principle Keep it simple, stupid!KISS-Prinzip
gen.lack of principlePrinzipienlosigkeit
tech.layer-substrate principleSchicht-Substrat - Prinzip
gen.Le Chatelier's principlePrinzip des kleinsten Zwanges
tech.leading principleLeitsatz
gen.lever principleHebelprinzip
tech.Locard's principleLocard-Prinzip
gen.lowest-value principleNiederstwertprinzip
med.luteinizing principleLuteinisierungshormon
med.luteinizing principlezwischenzellenstimulierendes Hormon
med.luteinizing principleGonadotropin B
med.luteinizing principleICSH
med.luteinizing principleProlan B
med.luteinizing principleLuteotropin
med.luteinizing principleLH
med.luteinizing principleluteinisierendes Hormon
gen.majority principleMajoritätsprinzip
gen.management principles for information technologyinformationstechnologierelevante Managementmethoden
econ., fin.market-oriented economic principlesmarktwirtschaftliche Prinzipien
tech.maximum material principleMaximum-Material-Prinzip
med.melanophore-expanding principlemelanophorenstimulierendes Hormon
med.melanophore-expanding principleMelanophorenhormon
med.melanophore-expanding principleMSH
med.melanophore-expanding principleMelanotropin
med.melanophore-expanding principlemelanozytenstimulierendes Hormon
gen.metallic sealing principle without gasketAbdichtprinzip (zwischendichtungsloses)
tech.method of images reflection principleSpiegelungsprinzip
tech.method of images reflection principleSpiegelungsmethode
construct.methodological principles of system designmethodologische Systemgrundlagen
gen.Minister for Employment, Labour and the Principle of Equal Opportunities for Women and MenMinister der Beschäftigung und der Arbeit, beauftragt mit der Politik der Chancengleichheit zwischen Männern und Frauen
mater.sc., construct.modular principleBaukastenprinzip
comp.modular principleModularprinzip
comp.modular principleBaukastenkonzeption
econ.monitoring of adherence to its political principlesÜberwachung der Einhaltung der politischen Grundsätze
philos.moral principlemoralischer Grundsatz (Andrey Truhachev)
philos.moral principlesmoralische Grundsätze (Andrey Truhachev)
philos.moral principlesMoralgrundsätze (Andrey Truhachev)
philos.moral principlesMoralprinzipien pl (Andrey Truhachev)
med.Nirvana principleNirvana-Prinzip
environ., UNNon-legally Binding Authoritative Statement of Principles for a Global Consensus on the Management, Conservation and Sustainable Development of All Types of ForestsWald-Grundsatzerklärung
environ., UNNon-legally Binding Authoritative Statement of Principles for a Global Consensus on the Management, Conservation and Sustainable Development of All Types of ForestsNicht rechtsverbindliche, massgebliche Darlegung von Grundsätzen eines weltweiten Konsenses über Bewirtschaftung, Erhaltung und nachhaltige Entwicklung aller Waldarten
econ., environ.Non-legally Binding Authoritative Statement of Principles for a Global Consensus on the Management, Conservation and Sustainable Development of all Types of Forestsnicht rechtsverbindliche, maßgebliche Darlegung von Grundsätzen eines weltweiten Konsenses über Bewirtschaftung, Erhaltung und nachhaltige Entwicklung aller Waldarten
gen.non-refoulement principleNon-Refoulement-Prinzip
gen.normally deenergized circuit principle UPC termArbeitsstromprinzip
IMF.Objectives and Principles for Regulation of SecuritiesZiele und Grundsätze der Wertpapieraufsicht
IMF.OECD Principles of Corporate GovernanceOECD-Grundsätze der Unternehmenssteuerung und -kontrolle
gen.on principleaus Prinzip
gen.on principlegrundsätzlich
gen.One-China principleEin-China-Politik
gen.open-circuit principleArbeitsstromprinzip
comp.operating principleArbeitsprinzip
comp.operating principleOperationsprinzip
econ.operating principlesArbeitsweise
econ.operating principlesGeschäftsgrundsätze
tech.ORDIR principleORDIR-Prinzip
brit.organisational principleOrganisationsprinzip
gen.organizational principleOrganisationsprinzip
med.Oudin principlesOudin-Prinzipien
gen.Paris PrinciplesPariser Grundsätze
gen.Paris principlesPariser Grundsätze
gen.partnership principlePartnerschaftsprinzip
biol.Pauli exclusion principlePauli-Fermi-Prinzip
biol.Pauli exclusion principlePauli-Prinzip
tech.Pauli exclusion principleAusschliessungsprinzip
biol.Pauli exclusion principleAusschließungsprinzip
biol.Pauli principlePauli-Fermi-Prinzip
biol.Pauli principlePauli-Prinzip
biol.Pauli principleAusschließungsprinzip
biol.Pauli-Fermi principlePauli-Fermi-Prinzip
biol.Pauli-Fermi principlePauli-Prinzip
biol.Pauli-Fermi principleAusschließungsprinzip
gen.physiopathological effects of the principle pollutants present in exhaust gasesphysiopathologische Wirkungen der wichtigsten in den Abgasen enthaltenen Schadgase
gen.plants working on the diffusion principleAnlagen, die nach dem Diffusionsverfahren arbeiten
gen.polluter pays principleVerursacherprinzip (Umweltschutz)
gen.precautionary principleVorsorgeprinzip
med.preparation with gradual release of the active principlePräparat mit progressiver Freisetzung des wirksamen Bestandteils
gen.prevail in principlegrundsätzlich vorliegen
gen.principle of arrangementOrdnungsprinzip
gen.principle of careSorgfaltsprinzip
gen.principle of causalityKausalprinzip
gen.principle of causalityKausalitätsprinzip
gen.principle of classificationOrdnungsprinzip
gen.principle of communicating vesselsPrinzip der kommunizierenden Röhren
gen.principle of completenessGrundsatz der Vollständigkeit Rechnungswesen
gen.principle of conferralGrundsatz der begrenzten Einzelermächtigung
gen.principle of conferral of powersGrundsatz der begrenzten Einzelzuständigkeit
gen.principle of conferral of powersGrundsatz der begrenzten Einzelermächtigung
obs., h.rghts.act.principle of democratic equalityGrundsatz der demokratischen Gleichheit
gen.principle of examination by the EPO of its own motionAmtsermittlungsgrundsatz
gen.principle of family unityGrundsatz der Familieneinheit
gen.principle of family unityGrundsatz der Einheit der Familie
inf.principle of indiscriminate all-round distributionGießkannenprinzip
gen.principle of individual preferential amountsPrinzip der Individualisierung der Präferenz beträge
geol.principle of lateral continuityPrinzip der ursprünglichen seitlichen Ausbreitung
gen.principle of lawRechtsgrundsatz
gen.principle of least actionPrinzip des geringsten Zwanges
gen.principle of least actionGesetz vom kleinsten Zwang
gen.principle of least constraintGesetz vom kleinsten Zwang
gen.principle of majority ruleMehrheitsprinzip
comp.principle of operationArbeitsprinzip
comp.principle of operationOperationsprinzip
geol.principle of orginal horizontalityHorizontalitätsprinzip
gen.principle of originator's consentGrundsatz der Zustimmung des Urhebers
gen.principle of parallel pay developmentParallelentwicklung der Bezüge
ecol.principle of proximityPrinzip der Nähe
med., psychol.principle of realityRealitätsprinzip
med.principle of segregationSpaltungsgesetz
med.principle of segregationzweites mendelsches Gesetz
med.principle of segregationSpaltungsregel
gen.principle of specific jurisdication defined by lawPrinzip der begrenzten Einzelzuständigkeit
gen.principle of targeting on the basis of riskGrundsatz der Auswahl nach Maßgabe des Risikos
gen.principle of the annual nature of the budgetJährlichkeitsgrundsatz
obs., h.rghts.act.principle of the equality of its citizensGrundsatz der demokratischen Gleichheit
gen.principle of the home countryHerkunftslandprinzip
gen.principle of the indivisibility of the premiumGrundsatz der Unabänderlichkeit des festgesetzten Entgelts
gen.principle of the leverHebelgesetz
gen.principle of the protection of legitimate expectationsGrundsatz des Vertrauensschutzes
gen.principle of the testTestprinzip
geol.principle of uniformityAktualismus
geol.principle of uniformityAktualitätsprinzip
gen.principle of universalityUniversalitätsprinzip
gen.principle of virtual displacementsPrinzip der virtuellen Verrückungen
gen.principle of virtual workPrinzip der virtuellen Arbeit
gen.principle of work and energyArbeitssatz
gen.principle that firms should cover their own overall costsGrundsatz der Gesamtkostendeckung
gen.principle that the Community's administration should be as transparent as a greenhouseGrundsatz der vollen Transparenz
gen.Principles and Guidelines on Children Associated With Armed Forces or Armed GroupsPariser Grundsätze
tax.principles applying to the attribution of profits to permanent establishmentsGrundsätze für die einer Betriebstätte zuzurechnenden Gewinne
f.trade.principles common to the Member StatesGrundsätze, die allen Mitgliedstaaten gemeinsam sind
gen.Principles for good international engagement in fragile states and situationsPrinzipien für internationales Engagement in fragilen Staaten
gen.Principles for good international engagement in fragile states and situationsGrundsätze für ein zweckmäßiges internationales Engagement in fragilen Staaten und Situationen
IMF.Principles for Stable Capital Flows and Fair Debt Restructuring in Emerging MarketsGrundsätze für stabile Kapitalströme und faire Schuldenumstrukturierung in aufstrebenden Märkten
comp., MSPrinciples for the data access and the testability of digital documents A German law that requires tax authorities to be capable of digitally checking data from electronic bookkeeping systemsGrundsätze zum Datenzugriff und zur Prüfbarkeit digitaler Unterlagen (GDPdU)
IMF.Principles for the Guidance of MembersLeitgrundsätze für die Wechselkurspolitik der Mitgliedsländer
IMF.Principles for the Guidance of Members' Exchange Rate PoliciesLeitgrundsätze für die Wechselkurspolitik der Mitgliedsländer
gen.principles governing the living and working conditions of migrant workersGrundsaetze für die Lebens- und Arbeitsbedingungen von Wanderarbeitnehmern
gen.principles laid down by law governing the professionsbestehende gesetzliche Grundsätze der Berufsordnung
lawprinciples of and general guidelines for the common foreign and security policyGrundsätze und Leitlinien der Gemeinsamen Außen-und Sicherheitspolitik
gen.principles of and general guidelines for the common foreign and security policyGrundsätze und allgemeinen Leitlinien der Gemeinsamen Aussen- und Sicherheitspolitik
ITprinciples of arrangementAufstellungsordnung
gen.principles of calculationBerechnungsgrundsätze
econ.principles of designKonstruktionsprinzipien
econ.principles of designKonstruktionsgrundlagen
fin.principles of economy, efficiency and effectivenessGrundsätze der Sparsamkeit, der Wirtschaftlichkeit und der Wirksamkeit
environ.principles of effectiveness, efficiency and equityGrundsätze der Wirksamkeit, Effizienz und Gerechtigkeit
min.prod.principles of general international lawGrundsätze des allgemeinen Völkerrechts
gen.principles of good conductWohlverhaltensgrundsätze
law, UNPrinciples of International cooperation in the detection, arrest, extradition and punishment of persons guilty of war crimes and crimes against humanityGrundsätze für die internationale Zusammenarbeit bei der Ermittlung, Festnahme, Auslieferung und Bestrafung von Personen, die Kriegsverbrechen und Verbrechen gegen die Menschlichkeit begangen haben
EU.principles of legality and proportionality of criminal offences and penaltiesGrundsätze der Gesetzmässigkeit und der Verhältnismässigkeit im Zusammenhangmit Straftaten und Strafen
econ.principles of managementManagementgrundsätze
econ.principles of managementFührungsgrundsätze
gen.principles of market economymarktwirtschaftliche Grundsätze
paint.principles of paintingPrinzipien der Malerei (Andrey Truhachev)
paint.principles of paintingGrundsätze der Malerei (Andrey Truhachev)
paint.principles of paintingGrundlagen der Malere (Andrey Truhachev)
econ.principles of peaceful coexistencePrinzipien der friedlichen Koexistenz
fin.principles of proper accountingGrundsätze ordnungsmäßiger Buchführung (etc.)
econ.principles of proper accountingBilanzierungsgrundsätze
construct.principles of regional developmentGrundsätze der Raumordnung
econ.principles of scientific managementGrundsätze wissenschaftlicher Betriebsführung
EU.principles of subsidiarity and proportionalityGrundsätze der Subsidiarität und der Verhältnismässigkeit
fin.principles of valuation set out in the GATTBewertungsgrundsätze des GATT
gen.Principles on the effective investigation and documentation of torture and other cruel, inhuman or degrading treatment or punishmentIstanbul-Protokoll
law, h.rghts.act., UNPrinciples on the effective investigation and documentation of torture and other cruel, inhuman or degrading treatment or punishmentGrundsätze für die wirksame Untersuchung und Dokumentation von Folter und anderer grausamer, unmenschlicher oder erniedrigender Behandlung oder Strafe
gen.Principles on the effective investigation and documentation of torture and other cruel, inhuman or degrading treatment or punishmentGrundsätze von Istanbul
h.rghts.act.Principles relating to the status of national institutionsGrundsätze betreffend die Stellung nationaler Institutionen zur Förderung und zum Schutz der Menschenrechte
gen.Principles relating to the status of national institutionsPariser Grundsätze
h.rghts.act.Principles Relating to the Status of National Institutions for the Promotion and Protection of Human RightsGrundsätze betreffend die Stellung nationaler Institutionen zur Förderung und zum Schutz der Menschenrechte
gen.Principles Relating to the Status of National Institutions for the Promotion and Protection of Human RightsPariser Grundsätze
lawprinciples that legitimate expectations must be protectedGrundsatz des Vertrauensschutzes
gen.principles, which all are of primary significancePrinzipien, die alle von grundlegender Bedeutung sind
gen.priority principlePrioritätsprinzip
gen.proportionality principleVerhältnismäßigkeitsgrundsatz
law, polit.Protocol on the application of the principles of subsidiarity and proportionalityProtokoll über die Anwendung der Grundsätze der Subsidiarität und der Verhältnismässigkeit
law, construct.Protocol on the application of the principles of subsidiarity and proportionalityProtokoll über die Anwendung der Grundsätze der Subsidiarität und der Verhältnismäßigkeit
gen.PSI Interdiction PrinciplesUnterbindungsgrundsätze der Sicherheitsinitiative
gen.to question the principleStreben nach Überdenken
comp.queueing principleWartezeitprinzip
comp.queuing principleWartezeitprinzip
tech.radiation principleStrahlungsprinzip
gen.radiological optimization principleradiologischer Optimisierunsgrundsatz
med., psychol.reality principleRealitätsprinzip
radiat.reciprocity principleReziprozitätsprinzip (of source and detector)
tech.reflected-light principle of scanningReflexionsabtastung
obs.Regulation laying down the rules and general principles concerning mechanisms for control by Member States of the Commission's exercise of implementing powersKomitologieverordnung
gen.Regulation laying down the rules and general principles concerning mechanisms for control by Member States of the Commission's exercise of implementing powersVerordnung über die Ausschussverfahren
gen.Regulation laying down the rules and general principles concerning mechanisms for control by Member States of the Commission's exercise of implementing powersVerordnung zur Festlegung der allgemeinen Regeln und Grundsätze, nach denen die Mitgliedstaaten die Wahrnehmung der Durchführungsbefugnisse durch die Kommission kontrollieren
gen.relativity principleRelativitätsprinzip
law, ADRrequired accounting principlesGrundsätze ordnungsgemäßer Buchführung
UNReview Conference on the Set of Multilaterally Agreed Equitable Principles and Rules for the Control of Restrictive Business PracticesKonferenz zur Überprüfung der Gesamtheit der multilateral vereinbarten Grundsätze und Regeln betreffend die Kontrolle handelsbeschränkender Praktiken
gen.Ritz's combination principleRitz'sches Kombinationsprinzip
transp., nautic., environ.Roadmap for Maritime Spatial Planning: Achieving Common Principles in the EUFahrplan für die die maritime Raumordnung: Ausarbeitung gemeinsamer Grundsätze in der EU
gen.rocket principleRaketenprinzip
gen.ruling principleLeitprinzip
gen.ruling principleleitendes Prinzip
gen.SADC principles and guidelines governing democratic electionsGrundsätze und Leitlinien der SADC für demokratische Wahlen
gen.scientific principlewissenschaftliches Prinzip
refrig.second principlezweiter Hauptsatz der Thermodynamik
gen.second principle of thermodynamicszweiter Satz der Thermodynamik
gen.second principle of thermodynamicszweiter Hauptsatz der Thermodynamik
refrig.second principle of thermodynamicszweiter Hauptsatz der Thermodynamik
gen.second principle of thermodynamicsEntropiesatz
f.trade.shall be governed by the following principlesgelten folgende Grundsätze
tech.sharing principleVerbundprinzip
fin., industr.Shipbuilding Injurious Pricing Code together with its Basic PrinciplesIPI-Kodex
fin., industr.Shipbuilding Injurious Pricing Code together with its Basic PrinciplesKodex gegen schädigende Preisgestaltung im Schiffbau
gen.Sonority PrincipleSonoritätsprinzip
gen.Special Committee for the Framework Agreement between the EC and Turkey on the general principles for the participation of Turkey in Community programmesSonderausschuss für das Rahmenabkommen zwischen der EG und der Türkei über die allgemeinen Grundsätze der Teilnahme der Türkei an den Programmen der Gemeinschaft
tech.spectrometer operating on the principle of detection by coincidenceSpektrometer mit Koinzidenzsdetektion
tech.spectrometer operating on the principle of detection by liquid scintillationSpektrometer mit Flüssigkeitszintallions-Detektion
pharma.Statement of principles governing the partnership between the EMEA and national competent authoritiesErklärung über die Grundsätze für die Beziehungen zwischen der EMEA und den zuständigen Behörden der Mitgliedstaaten
gen.stock adjustment principleAktienanpassungsprinzip
busin., ITstorage accounting principlesGrundsätze ordnungsmäßiger Speicherbuchführung
busin., ITstorage accounting principlesordnungsmäßiger Speicherbuchführung
gen.store-and-forward principleTeilstreckenverfahren
gen.strict application of and respect for these principles,in all their aspectsstrikte Anwendung und Achtung dieser Prinzipien in all ihren Aspekten
gen.structural principleAufbauprinzip
gen.subsidiarity principleSubsidiaritätsprinzip
gen.summation principleAdditionsprinzip
gen.superposition principleSuperpositionsprinzip
tech.supervisory principleÜberwachungsprinzip
tax.taxation principlesBesteuerungsgrundsätze
gen.That'd be against my principles.Das würde mir zuwiderlaufen.
gen.the common adherence to the principlesdie einmuetige Zustimmung zu den Prinzipien
lawthe ECB shall establish general principles for open market and credit operationsdie EZB stellt allgemeine Grundsätze für ihre eigenen Offenmarkt-und Kreditgeschäfte auf
work.fl.The EIB Complaints Mechanism - Principles, Terms of Reference and Rules of ProcedureBeschwerdeverfahren der EIB - Grundsätze, Aufgabenbeschreibung und Verfahrensregeln
gen.the fundamental principles governing the health surveillance of workersdie Grundsaetze für die aerztliche Ueberwachung der Arbeitskraefte
lawthe general principles common to the laws of the Member Statesdie allgemeinen Rechtsgrundsaetze,die den Rechtsordnungen der Mitgliedstaaten gemeinsam sind
food.ind., econ.The General Principles of Food Law in the European Union: Commission Green PaperGrünbuch zur Ernährungspolitik
food.ind., econ.The General Principles of Food Law in the European Union: Commission Green PaperAllgemeine Grundsätze des Lebensmittelrechts in der Europäischen Union - Grünbuch der Kommission
gen.the OSCE's governing principlesdie Leitprinzipien der OSZE
gen.the principle of collective effort in Alliancedas Prinzip der kollektiven Bündnisverteidigung
gen.the principle of full language coverVollsprachenregelung
gen.the principles of independence and equality for all peoplesdas Prinzip der Unabhaengigkeit und Gleichheit der Voelker
transp.the principles of the regulatory system for transportdie Grundsaetze der Verkehrsordnung
refrig.third principledritter Hauptsatz der Thermodynamik
refrig.third principle of thermodynamicsdritter Hauptsatz der Thermodynamik
gen.This position of the European Union is based on its general position for the Accession Conference with ... and is subject to the negotiating principles endorsed by the Accession Conference, in particular:Dieser Standpunkt der Europäischen Union beruht auf der allgemeinen Haltung der Europäischen Union in bezug auf die Beitrittskonferenz mit ... und unterliegt den von der Konferenz gebilligten Verhandlungsgrundsätzen, insbesondere den Grundsätzen, dass
busin.three basic principlesdrei grundlegende Gesichtspunkte
gen.to be present in principlegrundsätzlich vorliegen
lawtrade marks which are contrary to public policy or to accepted principles of moralityMarken, die gegen die öffentliche Ordnung oder gegen die guten Sitten verstoßen
gen.transactions based on the principle of reciprocityauf Gegenseitigkeit beruhende Geschäfte
med.transforming principletransformierendes Prinzip
astronaut., R&D.Treaty on Principles Governing the Activities of States in the Exploration and Use of Outer Space, including the Moon and Other Celestial BodiesVertrag über die Grundsätze zur Regelung der Tätigkeiten von Staaten bei der Erforschung und Nutzung des Weltraums einschliesslich des Mondes und anderer Himmelskörper
gen.Treaty on principles governing the activities of States in the exploration and use of outer space,including the moon and other celestial bodiesVertrag über die Grundsätze zur Regelung der Tätigkeiten von Staaten bei der Erforschung und Nutzung des Weltraums einschließlich des Mondes und anderer Himmelskörper
f.trade.Treaty principlesPrinzipien des EU-Vertrages
tech.two-cycle principleZweitaktsystem
gen.uniformitarian principleUniformitätsprinzip
tech.unit construction principleBaukastenprinzip
tech.unit principleEinheitsprinzip
law, h.rghts.act., UNUnited Nations principles on the effective prevention and investigation of extra-legal, arbitrary and summary executionsUN-Grundsätze für die wirksame Verhütung und Untersuchung von extralegalen, willkürlichen und summarischen Hinrichtungen
tech.velocity-modulation principleGeschwindigkeitsmodulations-Prinzip
biol.whole body principle clearanceGanzkörperclearance
ed.without principlesPrinzipienlosigkeit
gen.Wolfsberg Anti-Money Laundering AML PrinciplesWolfsberg-Prinzipien
tech.working principleArbeitsgrundlage
int. law., social.sc.Yogyakarta Principles on the Application of International Law in Relation to Issues of Sexual Orientation and Gender IdentityYogyakarta-Prinzipien zur Anwendung internationaler Menschenrechtsnormen und -standards in Bezug auf sexuelle Orientierung und Geschlechtsidentität
refrig.zero principlenullter Hauptsatz
Showing first 500 phrases

Get short URL