Terms containing Identification

Subject	English	Swedish
commun., IT	account identification	kontoidentifikation
transp., avia.	aircraft identification	luftfartygs identitet
transp., avia.	aircraft identification	identifiering av luftfartyg
transp., avia.	airport identification card	behörighetskort på flygplats
anim.husb.	animal identification	djuridentifiering
agric.	animal identification and movement recording system	registreringssystem för identifiering av djur och deras förflyttningar
transp.	automatic car identification	automatisk vagnidentifiering
IT, transp.	automatic car identification	automatisk fordonsidentifiering
int. law.	Automatic Fingerprint Identification System	automatiskt fingeravtrycksidentifieringssystem
telegr.	automatic identification	automatisk identifiering
IT	automatic identification control	verifiering av identitet
IT	automatic identification control	identifiering
commun.	automatic identification of outward dialing	detaljerad räkning för utgående samtal
commun.	automatic identification of outward dialling	detaljerad räkning för utgående samtal
transp., nautic., min.prod.	automatic identification system	automatiskt identifieringssystem
transp., nautic., min.prod.	automatic identification system	Automatic Identification System
commun.	automatic number identification	automatisk nummeridentifikation
el.	automatic number identification system	automatiskt nummeridentifieringssystem
commun., transp.	automatic vehicle identification	automatisk identifiering av fordon
transp.	automatic waggon identification	automatisk vagnidentifiering
fin.	bank account identification document	intyg om kontoinnehav
commun., IT	barring of calling party identification	identifieringsspärr
commun.	bibliographic identification	bibliografisk identifikation
commun.	bibliographic identification	biblid
commun.	billing identification number	BID-nummer
IT, tech.	biometric identification	biometrisk identifiering
transp., mil., grnd.forc.	bus identification and control system	trafikledningssystem för bussar
earth.sc., el.	cable identification sleeve	kabelmärkningshylsa
commun., IT	call origin identification field	fält för ursprungsindikering
el.	called line identification signal	identifieringssignal för anropad linje
el.	called-line-identification-request indicator	indikator för identifieringsförfrågan på anropad linje
commun.	caller identification	nummervisare
commun.	caller identification	nummervisning
commun.	Caller Line Identification	identifikation av uppringande nummer
commun.	calling line identification	nummeridentifikation
el.	calling line identification	identitet för anropande linje
commun.	calling line identification presentation	nummerpresentation
commun.	calling line identification presentation	presentation när det gäller identifiering av det anropande numret
commun.	calling line identification restriction	skydd mot nummerpresentation
commun.	calling line identification restriction	skydd när det gäller identifiering av det anropande numret
el.	calling line identification signal	identifieringssignal för anropande linje
commun.	calling number identification presentation	nummerpresentation
commun.	calling number identification restriction	skydd mot nummerpresentation
commun., IT	calling party identification	identifiering av anropande part
commun.	calling-line identification	nummerpresentation
commun.	calling-line identification	identifikation av uppringande nummer
commun.	calling-line identification presentation	nummerpresentation
el.	calling-line-identification-request indicator	indikator för identifieringsförfrågan på anropande linje
commun.	calling-party identification	identifikation av uppringande nummer
el.	carrier identification	operatörsprefix
el.	carrier identification code	operatörsindentifikationskod
agric.	Cattle identification Document	nötkreaturspass
gen.	cell global identification	global cellidentifikation
agric.	centralised national system for identification and registration of bovine animals	centraliserat nationellt system för identifiering och registrering av nötkreatur
el.	channel identification	kanalidentifiering
agric.	classification, identification and marking	klassificering, identifiering och märkning
life.sc.	cloud identification	molnidentifiering
IT	Cobol identification division	identifikationsdel
radio	colour identification signal	färgidentifieringssignal
transp., tech., law	colour identification test	färgidentifieringsprovning
commun.	connected line identification	identifiering av det uppkopplade numret
commun.	connected line identification presentation	presentation av uppkopplat nummer
commun.	connected line identification presentation	presentation när det gäller identifiering av det uppkopplade numret
commun.	connected line identification restriction	skydd mot presentation av uppkopplat nummer
commun.	connected line identification restriction	skydd när det gäller identifiering av det uppkopplade numret
commun.	connected number identification presentation	presentation av uppkopplat nummer
commun.	connected number identification restriction	skydd mot presentation av uppkopplat nummer
industr., construct., chem.	cord identification	identifiering av sliror
transp., avia.	crew identification card	identitetskort för besättningar
gen.	customs files identification database	register för identifiering av tullutredningar
el.	cycle identification	cykelidentifiering
commun., IT	data network identification code	datanätsidentifieringskod
h.rghts.act., commun., IT	de-identification	avidentifiering
commun.	dialed number identification service	dialled number identification number
commun.	dialled number identification service	dialled number identification number
commun.	dialog session identification	dialogidentifikation
el.	digital number identification sequence	digital identifieringssekvens
gen.	direct identification	direkt identifiering
IT, dat.proc.	disk identification character	skivenhetsbeteckning
IT, dat.proc.	disk identification code	skivenhetsbeteckning
IT, dat.proc.	disk identification letter	skivenhetsbeteckning
commun.	display system identification	systemidentifikation
health.	drug identification number	läkemedelsidentifikationsnummer
IT, el.	e-identification	e-identifiering
IT, el.	electronic identification	e-identifiering
comp., MS	employer identification number	employer identification number, federal tax id (In the United States, a 9-digit number that identifies a business entity to the government. A business must have an EIN if it has employees or meets other criteria specified by the federal government)
commun.	end of message identification	identifiering av meddelandeslut
environ.	environmental impact identification	identifiering av miljöpåverkan
med.	enzyme identification	enzymidentifikation
commun.	equipment identification number	terminalidentifieringsnummer
mech.eng.	equipment identification plate	märkskylt
transp., nautic.	European Long Range Identification and Tracking of Ships Data Centre	Europeiska unionens datacentral för långdistansidentifiering och -spårning av fartyg
gen.	European Long Range Identification and Tracking of Ships Data Centre	EU:s LRIT-datacentral
fish.farm.	external identification letters and numbers	distriktsbeteckning
fish.farm.	external identification number	distriktsbeteckning
IT	file identification	filidentifierare
gen.	financial identification sheet	blankett med bankuppgifter
transp., avia.	flight identification number	flygnings linjenummer
transp.	flight identification number	flygnummer
gen.	forensic identification	kriminalteknisk identifiering
h.rghts.act.	free self-identification	fri självidentifikation
IT, dat.proc.	function character identification parameter	identifikationsparameter för funktionstecken
commun.	function identification	funktionsidentifikation
stat.	geographic reference identification number	geografiskt referensidentifieringsnummer
comp., MS	global trade identification number	EAN artikelnummer (A 14-digit data structure used to uniquely identify trade items, products, and services at a unit level)
transp.	ground support point identification	markering av servicepunkter
commun.	group identification	gruppidentifikation
health., environ.	hazard identification	faroidentifiering
el.	identification aid	identifieringshjälpmedel
agric., health., anim.husb.	identification and registration of animals	identifiering och registrering av djur
IT, dat.proc.	identification authority	identifikationsmyndighet
IT, dat.proc.	identification authority management identification	identifikation av identifikationsmyndighet
gen.	identification beacon	igenkänningsfyr
gen.	identification beacon	identifikationsfyr
gen.	identification bracelets not of metal, for hospital purposes	identifikationsarmband, ej av metall, för sjukhus
gen.	identification bracelets of metal, for hospitals	identifikationsarmband av metall, för sjukhus
gen.	identification bracelets of metal for hospitals	identifikationsarmband av metall, för sjukhus
earth.sc.	identification by means of decay	identifiering genom sönderfall
el.	identification channel	identifieringskanal
agric.	identification code	identifikationskod
railw., sec.sys.	identification entry	tågnummerinmatning
el.	identification equipment	identifieringsutrustning
el.	identification field	identifieringsfält
commun., el.	identification friend or foe	igenkänningsradar
mech.eng.	identification friend or foe control panel	kontrollpanel för IFF
mater.sc.	identification lamp	signallampa
el.	identification leader	identifieringsfält
commun.	identification light	identifieringsljus
transp.	identification manoeuvre	identifieringsmanöver
agric., health., anim.husb.	identification mark	igenkänningsmärke
hobby, commun.	identification mark	frimärkssignatur
agric., health., anim.husb.	identification mark	identifikationsmärke
agric.	identification mark or seal	identitetsmärke eller sigill
IT	identification marking	identifieringsmärkning
fin.	identification measures	åtgärder för identifiering
agric.	identification note	upplysningsschema
el.	identification-not-provided signal	identification-not-provided-signal
stat.	identification number	identifieringsnummer
fin.	identification number	registreringsnummer
work.fl., IT	identification number	identifikationsnummer
el.	identification of a station	identifiering av en station
el.	identification of a station	bestämning av en station
immigr.	identification of a victim of trafficking in human beings	identifiering av offer för människohandel
anim.husb.	identification of animals	djuridentifiering
commun., IT	identification of faulty units	identifiering av felaktiga enheter
ed.	identification of learning outcomes	identifiering av studieresultat
el.	identification of radio signals	identifiering av radiosignaler
el.	identification of sources of interference	identifikation av störkällor
commun.	identification of the client	kundens identifikation
agric., met.	identification of the consignment	identifiering av leverans
fin., transp.	identification of the goods	identifiering av varor
commun.	identification of the interchange circuits	identifikation av gränssnittskretsarna
commun.	identification of the test item	testobjektets identifikation
commun.	identification of the test item	provningsobjektets identifikation
commun.	identification of the testing laboratory	provningslaboratoriums identifikation
transp., tech., law	identification-of-colours test	färgidentifieringsprovning
el.	identification pips	identifieringston
commun.	identification procedure	identifieringsförfarande
IT, dat.proc.	identification process	identifieringsprocess
transp., mater.sc.	identification prototype	serieprototyp
tax.	identification register	registreringsregister
telegr.	identification request	identitetsförfrågning
gen.	identification schema	identifieringsschema
gen.	identification sheaths for electric wires	märkhylsor för elektriska ledningar
law, IT, agric.	identification sheet	informationsblad
transp.	identification sign	identifikationstecken
el.	identification signal	identifieringssignal
law, econ., commun.	identification stamp	specialstämpel
agric.	identification tag	djurmärke
agric.	identification tally	djurmärke
gen.	identification threads for electric wires	tråd, märk-, för elektriska ledningar
commun., IT	incoming call identification	identifiering av inkommande samtal
commun., IT	incoming call identification on switched loop	identifiering på uppkopplad krets av inkommande samtal
IT, dat.proc.	initiating identification	initieringsidentifikation
comp., MS	Input Source Identification API	API för identifiering av indatakälla (A native API that, when an app gets input, tells the app what kind of hardware it came from)
IT	input/output interrupt identification	identifiering av avbrott vid in-och utmatning
fin., econ.	international securities identification number	internationellt standardnummer för värdepapper
gen.	International Securities Identification Number	ISIN-kod
fin., econ.	international security identification number	internationellt standardnummer för värdepapper
commun.	invalid mobile-identification	felaktigt mobil-ID
gen.	item counting and identification	räkning och identifiering av objekt
agric.	Land Parcel Identification System	system för identifiering av jordbruksskiften
commun., el.	lane identification	lane-identifiering
commun., el.	lane-identification meter	lane-identifieringsinstrument
commun., el.	lane-identification metre	lane-identifieringsinstrument
el.	lead identification	identifiering av kapselben
telegr.	line identification by the network	linjeidentifiering
transp., nautic.	Long-Range Identification and Tracking of Ships	långdistansidentifiering och -spårning av fartyg
commun.	malicious call identification	identifiering av okynnessamtal
commun., IT	malicious call identification	spårning av okynnessamtal
commun.	malicious call identification	spårning av samtal
commun.	malicious call identification service	samtalsspårning
cust.	means of identification	identifieringsmärken
cust., tax., econ.	Member State of identification	registreringsmedlemsstat
cust., tax., econ.	Member State of identification	identifieringsmedlemsstat
met.	microradiographic analysis permit an accurate identification of non-metallic inclusions	mikroradiografisk analys möjliggör en noggrann identifiering av ickemetalliska inneslutningar
commun.	mobile identification number	mobiltelefonnummer
el.	mode or type of communication identification	metod för kommunikationsidentifiering
commun.	network identification number	nätverks-ID-nummer
commun.	network identification number	nätverksidentifikationsnummer
commun.	numbering plan identification	numreringsplansidentifiering
commun.	object identification	objekt-ID
stat., scient.	over identification	överidentifiering
math.	over-identification	överidentifiering
IT, transp.	parameter identification	parameteridentifikation
IT, dat.proc.	personal identification mark	personnummer
comp., MS	personal identification number	PIN (A unique and secret identification code similar to a password that is assigned to an authorized user and used to gain access to personal information or assets via an electronic device)
commun.	personal identification number	PIN-kod
comp., MS	personal identification number	PIN-kod (A unique and secret identification code similar to a password that is assigned to an authorized user and used to gain access to personal information or assets via an electronic device)
gen.	personal identification number	personligt identifieringsnummer
gen.	physical verification by item counting and identification	fysisk verifiering genom räkning och identifiering av objekt
stat.	place identification,characteristics,area,distance,and direction	platsidentifiering, område, karaktär, avstånd och riktning
IT, transp.	positive train identification	aktiv tågidentifiering
commun.	presentation of calling and connected line identification	presentation när det gäller identifiering av det anropande och uppkopplade numret
commun.	presentation of calling line identification	presentation när det gäller identifiering av det anropande numret
commun.	presentation of the connected line identification	presentation när det gäller identifiering av det uppkopplade numret
commun., IT	procedure for identification of terminals	procedur för identifiering av terminaler
environ.	product identification	produktidentifiering
environ.	product identification Attaching a notice to a product or container bearing information concerning its contents, proper use, manufacturer and any cautions or hazards of use	produktidentifiering
IT, el.	product identification label	produktidentifikationsskylt
IT, el.	product identification label	produktidentifikationsetikett
commun.	programme identification signal	programigenkänningssignal
commun.	programme identification signal	identifieringssignal för program
commun., transp.	programme identification system	programidentifieringssystem
commun.	radar target identification and echo enhancement	radarmålidentifikation och ekoförstärkning
comp., MS	radio frequency identification	radiofrekvensidentifikation (A technology that uses radio frequencies to identify products. An RFID-capable product has an RFID tag that can transmit information, such as serial number, to an RF reader, which converts the information into digital data that can be sent to a computer)
comp., MS	radio frequency identification	radiofrekvensidentifiering (A technology that uses radio frequencies to identify products. An RFID-capable product has an RFID tag that can transmit information, such as serial number, to an RF reader, which converts the information into digital data that can be sent to a computer)
comp., MS	radio frequency identification sensor	sensor för identifiering av radiofrekvens (A type of sensor (such as a proximity sensor) that uses radio frequency identification (RFID) for a numerous purposes, such as identification of physical items, automatic log on, location of people, etc)
industr., construct., chem.	ream identification	identifiering av sliror
commun., IT	recall identification display	teckenfönster för identifiering av återanropande part
el.	red identification strip	rött identifikationsband
commun.	registration identification	REGID-variabel
commun.	restriction of calling and connected line identification	skydd när det gäller identifiering av det anropande och uppkopplade numret
commun.	restriction of calling line identification	skydd när det gäller identifiering av det anropande numret
commun.	restriction of the connected line identification	skydd när det gäller identifiering av det uppkopplade numret
commun., IT	room identification	presentation av rumsnummer i hotellväxel
commun., transp.	runway identification	ljusmärkning av start och landningsbana
environ.	scene identification	identifiering av bildutsnitt fjärranalys
environ.	scene identification A numeric string which uniquely identifies an image component of a geographical information system database	identifiering av bildutsnitt
commun.	selective call identification number	identifieringsnummer för selektivt anrop
commun.	service identification	tjänsteidentifiering
fin.	shareholder identification	identifiering av aktieägare
transp.	ship-identification system	system för fartygsidentifiering
railw., sec.sys.	signal identification plate	signalidentitetstavla
el.	site identification number	sajt-identitifikationsnummer
el.	site identification number	centralidentifikationsnummer
commun.	station identification	apparatidentifiering
commun.	station program identification	programidentifiering av station
commun.	station programme identification	programidentifiering av station
commun.	subscriber identification	abonnentidentifiering
commun.	subscriber identification module	SIM-kort
chem.	substance identification	ämnesidentifiering
met.	symbol of identification	märkning
chem.	system for the identification and traceability of explosives for civil uses	system för identifiering och spårning av explosiva varor för civilt bruk
commun.	system identification	system-ID
commun.	system identification	systemidentifikation
commun.	system identification number	system-ID-nummer
commun.	system identification number	systemidentifikationsnummer
commun.	system identification number	SID-nummer
commun.	system identification,permanently stored	permanent lagrat system-ID
commun.	system identification,permanently stored	permanent lagrad system-ID
commun.	system identification,received	mottaget system-ID
commun.	system identification,received	mottagen system-ID
commun.	system identification,semi-permanently stored	semi-permanent lagrat system-ID
commun.	system identification,semi-permanently stored	semi-permanent lagrad system-ID
commun.	system identification,stored	lagrat system-ID
commun.	system identification,stored	lagrad system-ID
el.	tape identification strip	bandidentifieringsremsa
tax.	tax identification number	skatteregistreringsnummer
comp., MS	taxpayer identification number	taxpayer identification number, organisationsnummer (A 9-digit number used to identify an entity (company or person) for tax reporting purposes in the U.S. There are several different types of tax identification numbers, such as employer identification number (EIN), Social Security number (SSN), individual taxpayer identification number (ITIN), and adopted taxpayer identification number (ATIN))
fin., tax.	taxpayer identification number	ID-nummer för skattebetalare
commun.	telegram identification group	telegramidentifikationsgrupp
commun.	telex network identification code	nätidentifieringskod för telex
commun.	terminal identification	terminalidentifieringsnummer
commun., IT	terminal identification	terminalidentifiering
commun., IT	terminal identification	identifiering av en terminal
IT	terminal identification code	terminalidentifieringskod
transp., avia.	threshold identification lights	tröskelidentifieringsljus
environ.	toxic and dangerous waste identification system	identifieringssystem för gift-och riskavfall
market.	trade mark identification elements	kännetecknande element i varumärket
commun., transp.	traffic information identification signal	identifieringssignal för trafikinformation
gen.	train identification	tågidentifiering
IT, transp.	train identification reporting system	tåganmälan
commun., transp.	transmitter identification signal	signal för identifiering av radiostation
IT	trunk identification	trunkledningsidentifiering
health., med.	unique device identification	unik produktidentifiering
commun., IT	user identification	användar-ID
commun., IT	user identification	användaridentitet
IT	user identification	användaridentifiering
commun.	vacant mobile identification	oanvänt mobil-ID
commun.	vacant mobile identification	ledigt mobil-ID
tax.	value added tax identification number	registreringsnummer för mervärdesskatt
tax.	value added tax identification number	momsregistreringsnummer
tax.	value added tax identification number	mervärdesskatteregistreringsnummer
tax.	VAT identification number	momsregistreringsnummer
tax.	VAT identification number	registreringsnummer för mervärdesskatt
tax.	VAT identification number	mervärdesskatteregistreringsnummer
IT, transp.	vehicle identification	vagnsnummer
IT, transp.	vehicle identification	fordonsnummer
law, transp.	vehicle identification number	fordonets identifieringsnummer
med., pharma.	worldwide unique case identification number	fallets världsunika ID-nummer