DictionaryForumContacts

Terms containing Recovery | all forms | exact matches only
SubjectEnglishDutch
ITabend recovery programherstelprogramma na abnormale beeindiging
met.acid recoveryterugwinning van zuur
fin.action for post-clearance recoverynavordering
lawaction for recovery of a mortgagevordering van de hypotheekhouder
law, busin., labor.org.action for recovery of movable propertyvordering tot opvordering van roerend goed
lawaction for recovery of propertyrechtsvordering tot teruggave
lawaction for the recovery of payment made by mistakeactie uit onverschuldigde betaling
hobby, transp.aerial recovery canopybergingsscherm
crim.law., ITafter theft system for vehicle recoverynadiefstalsysteem voor voertuigen
crim.law., ITafter theft system for vehicle recoverysysteem voor het traceren van gestolen voertuigen
crim.law., ITafter theft system for vehicle recoveryna-diefstalsysteem
gen.armoured recovery vehiclebergingstank
crim.law.asset recoveryontneming van vermogensbestanddelen
fin.asset recoveryterughalen van activa
crim.law.Asset Recovery Officebureau voor de ontneming van vermogensbestanddelen
tax.assistance in recoverybijstand bij invordering
fin.authorisation of recoveryinvorderingsopdracht
econ.authorisation of recoveryopdracht tot invordering
comp., MSauthoritative recoverybindend terugzetten (In Backup, a type of restore operation performed on an Active Directory domain controller in which the objects in the restored directory are treated as authoritative, replacing (through replication) all existing copies of those objects)
IT, tech.backward file recoverybestandsrestauratie
IT, tech.backward recoverybestandsrestauratie
gen.Bank Recovery and Resolution Directiverichtlijn herstel en afwikkeling van banken
comp., MSbare-metal recoverybare metal recovery (A recovery of a system using a backup that contains critical volumes and, optionally, data files that you can use to rebuild a system from scratch or rebuild a system using alternate hardware)
med.bed in the recovery roomverkoeverbed
chem., el.benzol recoverybenzolwinning
chem., el.benzol recoverydebenzolering
chem., el.benzol recoverybenzolverwijdering
coal., met.benzole recoverybenzolwinning
coal., met.benzole recoverybenzolwassing
environ.biological recoverybiologische regeneratie
fish.farm.biological recovery periodgesloten visseizoen
fish.farm.biological recovery periodgesloten seizoen
el.bit timing recoverybittijdbasisterugwinning
comp., MSBitLocker recovery keyBitLocker-herstelsleutel (A special key that you can create when you turn on Bitlocker Drive Encryption for the first time on each drive that you encrypt)
met.blast furnace gas recovery turbinehoogovenexpansieturbine
econ.business recovery planningrampenplanning
coal., met.by-product recoverybijproduktenfabriek
coal., met.by-product recovery plantbijproduktenfabriek
crim.law., social.sc.Camden Assets Recovery Interagency NetworkCamden Assets Recovery Inter-Agency Network
market.Capital recovery factorannuïteitsfactor bij terugbetaling
el.carrier recovery circuitdraaggolfherwinningscircuit
fin.cause of non-recoveryoorzaak van het niet terugvorderen
environ.certificate of recoveryverklaring van nuttige toepassing
environ., chem.CFC recoveryterugwinning van de chloorfluorkoolwaterstoffen
environ., chem.CFC recoveryterugwinning van de CFK's
econ.charges which may be imposed in connection with the collection or recovery of taxes outstandingeventueel bijkomende inningskosten
environ., chem.chlorofluorocarbon recoveryterugwinning van de chloorfluorkoolwaterstoffen
environ., chem.chlorofluorocarbon recoveryterugwinning van de CFK's
oilClaus sulphur recovery plantClaus zwavelterugwinningsinstallatie
IT, el.clock recoveryklokherstel
el.clock recovery bitklokterugwinningsbit
commun., el.clock recovery boardklok recovery-bord
ITclock recovery circuitfase-correctie circuit
ITclock recovery circuitcircuit voor fasecorrectie
el.clock timing recoverykloktijdterugwinning
chem., el.cold recovery plantkoudeterugwinningsinstallatie
fin.commitment, payment and recoverybetalingsverplichting, verrichte betaling en terugvordering
commun., ITcommitment,concurrency and recovery relationshipcommitment,concurrency en recovery-relatie
commun., ITcommitment,concurrency and recovery relationshipCCR-relatie
fin., polit.Committee on RecoveryComité voor invordering
gen.Committee on recoveryComité voor invordering
tax.Committee on Recovery of ClaimsComité invordering
mun.plan.condensate recovery systemcondenswaterrecuperatiesysteem
fin.condition of recoveryde stand van de terugvordering
gen.consult manufacturer/supplier for information on recovery/recyclingraadpleeg fabrikant/leverancier voor informatie over terugwinning/recycling
econ., patents.control of the recovery of revenuecontrole op de inning van de ontvangsten
gen.Convention between the Member States of the European Communities on the Simplification of Procedures for the Recovery of Maintenance PaymentsVerdrag tussen de lidstaten van de Europese Gemeenschappen betreffende de vereenvoudiging van de procedures voor het verhaal van vorderingen inzake onderhoudsverplichtingen
law, proced.law.Convention on the international recovery of child support and other forms of family maintenanceVerdrag inzake de internationale inning van levensonderhoud voor kinderen en andere familieleden
gen.Convention on the Recovery Abroad of MaintenanceVerdrag onderhoudsverhaal in het buitenland 1956
gen.Convention on the Recovery Abroad of MaintenanceVerdrag inzake het verhaal in het buitenland van uitkeringen tot onderhoud
gen.Convention respecting the Limitation of the Employment of Force for the Recovery of Contract DebtsVerdrag nopens de beperking van het gebruik van wapengeweld bij het innen van schulden uit overeenkomst
fin., transp.cost recoverydoorberekening van kosten
transp.cost recoveryhet terugverdienen van kosten
fin., transp.cost recoverydekking van kosten
environ.cost recovery basis A standard used to provide reimbursement to individuals or organizations for any incurred expense or provided servicevolledige kostendekking
environ.cost recovery basisvolledige kostendekking
fin.cost recovery principleprincipe van kostendekkende exploitatie
comp., MScrash recoverycrashherstel (The ability of a computer to resume operation after a disastrous failure, such as the failure of a hard drive. Ideally, recovery can occur without any loss of data, although usually some, if not all, data is lost)
industr., construct.crease-recoverylendheid
industr., construct.crease-recoverykreukherstel
industr., construct.cross recoverygecombineerde loogregeneratie
fin.cumulative recovery systemcumulatieve restitutieregeling
econ.cyclical recoveryconjunctuurherstel
med.dark recoveryherstel in duisternis
ITdata recoverygegevensherstel
ITdata recoverydataterugwinning
patents.data recovery servicesdiensten op het gebied van gegevensterugwinning
fin.debt recoveryinvordering van de schulden
law, fin.debt recoveryinvordering
law, fin.debt recoveryinning van vorderingen
environ.Decision of the OECD Council of 30 March 1992 on the control of transfrontier movements of wastes destined for recovery operationsOntwerp-besluit van de OESO betreffende het toezicht op grensoverschrijdende overbrenging van afvalstoffen bestemd voor handelingen ter nuttige toepassing
commer.decision ordering recoverybeschikking waarbij terugvordering wordt gelast
chem., el.direct sulphate recoverybereiding van ammoniumsulfaat volgens de directe methode
fin.Directive establishing a framework for the recovery and resolution of credit institutions and investment firmsrichtlijn betreffende de totstandbrenging van een kader voor het herstel en de afwikkeling van kredietinstellingen en beleggingsondernemingen
gen.Directive establishing a framework for the recovery and resolution of credit institutions and investment firmsrichtlijn herstel en afwikkeling van banken
IT, corp.gov.Disaster Recovery Planuitwijkplan
gen.disaster recovery planningnoodvoorzieningenplan
gen.disaster recovery planningbeveiliging tegen calamiteiten
IT, corp.gov.disaster recovery siteuitwijklocatie
transp.drogue recoveryberging met behulp van stabilisatiescherm
environ.ecological recoveryecologisch herstel
environ.ecological recoverymilieusanering
environ.ecological recoveryecologische sanering
lab.law.economic and social recovery plansociaal-economisch herstelplan
econ.economic recoveryconjuncturele heropleving
fin.economic recoveryverbetering in de conjunctuur
econ.economic recoveryopleving van de economie
econ.economic recoveryconjunctureel herstel
econ., fin.economic recoveryherstel van de economie
econ.economic recoveryeconomisch herstel
econ., fin.economic recovery loan ERLlening toegestaan om economisch herstel van een land te bevorderen
econ., fin.economic recovery programmeeconomisch herstelplan
industr., construct.elastic recoveryelastisch vermherstel
tech.elastic recoveryelastische restitutie
environ.energy recoveryenergie-herwinning
environ.energy recovery A form of resource recovery in which the organic fraction of waste is converted to some form of usable energy. Recovery may be achieved through the combustion of processed or raw refuse to produce steam through the pyrolysis of refuse to produce oil or gas; and through the anaerobic digestion of organic wastes to produce methane gasenergie-herwinning
econ.energy recoveryterugwinning van energie
environ.energy recovery from compostingenergiewinning d.m.v.compostering
insur., busin., labor.org.enforced recoveryinning met dwangmiddelen
law, fin.enforced recoverygedwongen terugvordering
law, transp., avia.enforced recovery of route chargesinvordering in rechte van "en route"-heffingen
energ.ind.Enhanced Hydrocarbon Recoverybegeleide terugwinning van koolwaterstoffen
energ.ind., oilenhanced oil recoveryverbeterde oliewinning
energ.ind.enhanced recovery of hydrocarbonsbegeleide terugwinning van koolwaterstoffen
fin.to ensure the recovery of a chargede inning van een heffing verzekeren
lawentitled to seek recoveryverhaalsgerechtigde
ITerror recoveryfoutenherstel
ITerror recovery procedurefoutenherstelprocedure
chem.establishment undertaking a recoveryonderneming die stoffen terugwint
chem.establishment undertaking a recoveryterugwinningsbedrijf
chem.establishment undertaking a recoveryfabrikant van een teruggewonnen stof
fin.EU framework for bank recovery and resolutionEU-kader voor herstel en afwikkeling van banken
econ.European Economic Recovery PlanEuropees economisch herstelplan
fin., energ.ind.European Energy Programme for RecoveryEuropees energieprogramma voor herstel
law, fin.European network of offices for recovery of the proceeds of crimeEuropees netwerk van invorderingsbureaus van criminele vermogensbestanddelen
environ., industr., polit.European Recovery and Recycling AssociationEuropese Vereniging voor de inzameling en het hergebruik van afval
lawEuropean Recovery ProgramMarshall Plan Hulp
lawEuropean Recovery ProgramEuropese Herstel-Programma
environ.European Recovery ProgrammeEuropese Herstelprogramma
environ.European Recovery ProgrammeEuropese Herstel-Programma
fin.European Recovery Programme Marshall PlanEuropees Herstelprogramma Marshallplan
environ., industr., polit.European Recycling and Recovery AssociationEuropese Vereniging voor de inzameling en het hergebruik van afval
lawexercising a right of recoveryuitoefening van de revindicatie
econ.factor underlying the recoveryherstelfactor
ITfailure recoveryherstart na storing
IT, dat.proc.fallback recoveryuitwijkterugkeer
IT, dat.proc.fallback recoveryherstel tot normaal verloop
IT, dat.proc.fallback recoveryterugkeer
industr., construct.fibre recoveryterugwinning van vezels
IT, dat.proc.file backup and recoverybestandswaarborg
chem.final recoveryuiteindelijke terugwinning
econ., fin.financial balance of the recovery planfinanciëel evenwicht van het herstelplan
econ., fin.Five-year Programme of Action for African Economic Recovery and DevelopmentVijfjarig actieprogramma voor de economische heropleving en ontwikkeling in Afrika
market.fixed investments-rights to recovery of a debtoverige effecten
market.fixed investments-rights to recovery of a debtandere aandelen
earth.sc., mech.eng.flow rate recoverydebietrendement
fin., insur.forced recoveryinning met dwangmiddelen
el.forward recovery timedoorlaat-vertragingstijd
el.forward recovery voltagedoorlaat-vertragingsspanning
el.forward-recovery voltage peakspanningspiek bij doorlaat-vertraging
commun.frame alignment recoveryherstel van framesynchronisatie
el.frame alignment recovery timetijd voor herstel van framesynchronisatie
el.frame alignment recovery timetijd voor het opnieuw synchroniseren van het raster
el.frame alignment recovery timerastervergrendelingsterugwinningstijd
fin.framework for the recovery and resolution of credit institutions and investment firmsEU-kader voor herstel en afwikkeling van banken
el.furnace recovery timewederopwarmingstijd van een diffusie-oven
chem.gas recovery plantgasterugwinningsinstallatie
energ.ind.geothermal recovery factorwinningsfaktor
comp., MSgraceful recoveryherstel met behoud van functionaliteit (Termination of a process that allows the operating system or parent process to regain normal control. Does not crash the machine or result in a general protection default (GPF) or blue screen. The user is not required to close the application, and can continue to use the other functionality)
econ.group recovery servicesgroep handel in schroot
fin.Guaranteed Recovery of Investment Principal Program, GRIPterugbetalingswaarborg voor de inbreng van de investeerder
earth.sc.half amplitude recovery timehersteltijd tot halve amplitude
mun.plan.heat recovery and extract systemwarmteterugwinnings-en droogsysteem
patents.heat-recovery apparatusapparaten voor het terugwinnen van warmte
earth.sc., el.heat recovery systemsysteem voor terugwinnen van warmte
lab.law.human recoverymenselijke herstelacties
energ.ind., oilimproved oil recoveryverbeterde oliewinning
chem., el.indirect sulphate recoveryberiding van ammoniumsulfaat volgens de indirecte methode
fin.to insure recovery of funds lentwaarborg voor de inning van de schuldvordering
fin.to issue a recovery orderafgifte van een invorderingsopdracht
fin.to issue a recovery orderafgifte van een inningsopdracht
fin.issue recovery ordersinningsopdrachten afgeven
ITjob-recovery control filereservebestand
econ., unions.jobless recoverybanenloze groei
econ., unions.jobless recoverybanenloos herstel
ITkey recoveryherberekening van de sleutel
comp., MSkey recoverysleutelherstel (The process of recovering a user's private key)
ITkey recovery schemesleutel-terugberekeningsregeling
energ.ind.kinetic energy recoveryterugwinning van kinetische energie
earth.sc.lake recovery projectproject voor sanering van het meer
el.load recoveryterugkeer van de belasting
commun., ITlunar resource recoveryexploratie van hulpbronnen van de maan
med.marked capacity for recoverysterk vermogen om zich te herstellen
econ.market recoveryherstel van de markt
industr., construct.metal recovery through chemical beneficiationterugwinning van metalen door chemisch verrijken
obs.Millennium Africa Recovery PlanMillenniumprogramma voor Afrika
obs.Millennium Partnership for the African Recovery ProgrammeMillenniumprogramma voor Afrika
obs.Millennium Partnership for the African Recovery ProgrammeMillenniumpartnerschap voor het herstelprogramma voor Afrika
lawminimal time for recovery of investmentsminimum terugverdientijd
fin.monitoring of recovery of own resourcescontrole op de inning van de eigen middelen
fin.mutual assistance for recoverywederzijdse bijstand inzake invordering
econ.national recovery plannationaal herstelplan
lawNew York Convention of 20 June 1956 on the recovery abroad of maintenanceVerdrag van New-York van 20 juni 1956 betreffende de invordering van onderhoudsbijdragen in het buitenland
comp., MSnon-authoritative recoveryniet-bindend terugzetten (A restore operation performed on an Active Directory domain controller in which the objects in the restored directory are not treated as authoritative. The restored objects are updated with changes held on other domain controllers in the domain)
fin.non-inflationary recoverynon-inflatoir herstel
environ.OECD classification list of wastes destined for recovery operationsOESO-indeling van afvalstoffen bestemd voor nuttige toepassing
mech.eng.oil recoveryolieterugwinning
gen.oil recovery shipoliebestrijdingsvaartuig
gen.oil recovery shipoliebestrijdingsschip
chem.oil recovery techniquesoliewinningstechnieken
environ.oil recovery vesselolieopruimingsschip
environ.oil recovery vessel Boats used for recovering oil spilled at sea from oil tankers. The recommended procedure is to contain and physically recover the spill with or without the use of adsorbents. This approach entails three processes: 1. confinement of the spill by spill booms; 2. recovery of the spill by sorbing agents; 3. physical removal of the contained oil by oil pick-up devicesolieopruimingsschip
environ.oil recovery vesselopruimingsschip
environ.one-step recovery unitééntraps-VRU
commun., el.OOS recoveryout-of-service recovery
environ.packaging recoverable in the form of energy recoveryterugwinning van verpakking in de vorm van energieterugwinning
nat.sc.passive flue gas heat recovery deviceinstallatie voor passieve warmteterugwinning uit het rookkanaal
nat.sc.passive flue heat recovery deviceinstallatie voor passieve warmteterugwinning uit het rookkanaal
insur., lab.law.pension recoveryherstel van het recht op pensioen
gen.personnel recoveryterughalen van personeelsleden
environ.petrol vapour recoverybenzinedampterugwinning
chem.polymer for oil recoverypolymeer voor olieterugwinning
fin., polit.post-clearance recoverynavordering
fin., polit., tax.post-clearance recovery of import duties or export dutiesnavordering van de rechten bij invoer of bij uitvoer
gen.post-conflict recoveryherstel na een conflict
earth.sc., mech.eng.power recoveryvermogensrendement
mech.eng.power recovery turbinevermogenterugwinturbine
el.power-frequency recovery voltagewederkerende spanning van netfrequentie
environ.pre-authorized recovery facilityvooraf goedgekeurde inrichting voor nuttige toepassing
earth.sc., mech.eng.pressure recoverydrukrendement
earth.sc., transp.pressure recoverydrukherstel
coal.primary recoveryprimaire winning
fin.pro rata temporis recovery of the aidterugvordering van de steun pro rata temporis
lawproceedings for the recovery of damagesvordering tot schadevergoeding
lawproceedings for the recovery of feesrechtsvordering tot inning van honoraria
industr., construct., chem.product thickness recoveryherstel van produktiedikte
econ.products of the group "Recovery services"produkten van de groep schroot en andere afvalstoffen
econ., fin., UNProgramme for economic recovery and development in AfricaProgramma voor het economisch herstel en de ontwikkeling van Afrika
econ.Programme for National Recoverynationaal herstelprogramma
gen.Programme to assist economic reform and recovery in the New Independent States and MongoliaProgramma voor bijstand aan de Nieuwe Onafhankelijke Staten en Mongolië bij de sanering en het herstel van hun economie
econ.Programme to promote economic reform and recovery in the New Independent States and MongoliaProgramma ter bevordering van de economische hervormingen en het herstel van de economie in de Nieuwe Onafhankelijke Staten en Mongolië
el.prospective transient recovery voltageideële wederkerende spanning
food.ind., UNProtracted Relief and Recovery OperationLanglopende Hulpverlenings- en Hersteloperatie
earth.sc., mech.eng.purge recovery systemontluchtingsapparaat
earth.sc., transp.ram pressure recoveryomzetting van totale druk in statische druk in inlaatkanaal
earth.sc., transp.ram recoveryomzetting van totale druk in statische druk in inlaatkanaal
environ., industr.rate of recoveryterugwinningspercentage
gen.Reconstruction and Recovery Programme for Kosovowederopbouw-en herstelprogramma voor Kosovo
health.recoveries effectedteruggevorderde bedragen
nat.sc., agric.recovery abilityvermogen om opnieuw uit te lopen
account.recovery actioninvorderingsactie
insur.recovery agentinvorderingsagent
comp., MSrecovery agentherstelagent (A person who is issued a public key certificate for the purpose of recovering user data that is encrypted with Encrypting File System (EFS))
fin.recovery and resolution planherstel- en afwikkelingsplan
met.recovery annealingherstelgloeien
met.recovery by dry filtrationterugwinning via droge filtratie
earth.sc.recovery by using inert gas bubblingterugwinnen via het spoelen met inert gas
ITrecovery circuiteenheid voor het herstellen
life.sc.recovery cycleaanvullingscyclus
el.recovery diodeschakeldiode
el.recovery diodeboosterdiode
earth.sc.recovery effect of nucleic acidshersteleffect van nucleïnezuren
energ.ind.recovery factorwinningsfaktor
transp.recovery flapduik-afvangklep
astronaut., transp.recovery from a maximum slipherstellen van een maximale slip
commun., ITrecovery from fall-backuitwijkterugkeer
commun., ITrecovery from fall-backterugkeer
industr.recovery gaskoepelgas
gen.recovery gridterugwinningsrooster
econ.recovery laweconomische herstelwet
agric.recovery loadinhaalkracht
comp., MSrecovery mediaherstelmedium (Media provided by the OEM to the customer that enables the customer to repair or reinstall their installation of Windows)
chem.recovery methodwinningstechniek
chem.recovery methodwinningsmethode
transp.recovery of a bituminous materialterugwinning van bitumineus materiaal
insur.recovery of a rightherkrijgen van een recht
insur.recovery of a right to benefitsherstel van een recht op prestaties
life.sc.recovery of a survey control stationreconstructie van een bekend punt
lawrecovery of all revenue of the Officeinning van alle ontvangsten van het Bureau
insur.recovery of benefits provided but not dueterugvordering van ten onrechte verleende verstrekkingen
insur.recovery of benefits provided but not dueterugvordering van de onrechtmatig ontvangen prestaties
insur., sociol.recovery of benefits which were not dueterugvorderen van onverschuldigde prestaties
insur., sociol.recovery of benefits which were not dueterugvordering van onverschuldigde prestaties
insur., sociol.recovery of benefits which were not dueterugvorderen van onrechtmatig ontvangen prestaties
energ.ind., mech.eng.recovery of braking energyterugwinning van remenergie
fin.recovery of chargesverhaal van rechten
gen.recovery of chargesverhaal van de rechten
fin., commun.recovery of charges,etc.verhaling van rechten,enz.
fin.recovery of claimsinvordering van schuldvorderingen
coal., met.recovery of coke oven light oilbenzolwinning
coal., met.recovery of coke oven light oilbenzolwassing
patents.recovery of computer dataherstel van computergegevens
insur., transp., construct.recovery of contributionsinning van premies of bijdragen
insur., transp., construct.recovery of contributionsinvordering van premies of bijdragen
crim.law.recovery of criminal assetsontneming van vermogensbestanddelen
coal., met.recovery of crude coal tarteerverwijdering
coal., met.recovery of crude coal tarteerwinning
coal., met.recovery of crude coal tarteerscheiding
coal., met.recovery of crude coal tarteerafscheiding
econ.recovery of domestic demandopleving van de binnenlandse vraag
agric.recovery of edible proteinswinning van eetbare eiwitten
insur.recovery of expenses incurred in the payment of benefitsin rekening brengen van de kosten verbonden aan de uitbetaling van de uitkeringen
earth.sc., construct.recovery of headterugwinnen van drukhoogte
stat.recovery of informationrecuperatie van informatie
math.recovery of informationgebruik van tussenblok-informatie volgens Yates
environ.recovery of landscape Reclamation measures taken to restore the environmental quality level of a landscape to its predisturbed conditionlandschapsherstel
environ.recovery of landscapelandschapsherstel
environ., industr.recovery of materialsnuttige toepassing voor materiaal
lawrecovery of movable property belonging to the bankrupt's spouseterugneming van roerend goed door de echtgenoot van de gefailleerde
lawrecovery of movable property under ordinary lawrevindicatie van roerend goed volgens het gemene recht
chem.recovery of precious metalterugwinning van het edele metaal
lawrecovery of propertyoverneming van goederen
el.recovery of residual heatterugwinning van restwarmte
fish.farm.recovery of stockshet weer op peil brengen van een bestand
fish.farm.recovery of stockshet herstellen van een bestand
lawrecovery of sums paid out by way of legal aidterugvordering van de bedragen uitbetaald ter zake van toelating om kosteloos te procederen
tax.recovery of tax claimsinvordering van belastingvorderingen
commer., polit.recovery of the amount of the customs debtinvordering van het bedrag van de douaneschuld
econ.recovery of the marketherstel van de markt
lawrecovery of the marriage portionterugvordering van het huwelijksgoed
transp., el.recovery of the overhead lineopbreken van de bovengrondse leiding
social.sc.recovery of the right to benefitsherstel van het recht op prestaties
tax.recovery of the tax not previously due because of reduced taxationinvordering van de vroegere belastingvermindering
fin., tax.recovery of undue paymentterugvordering van hetgeen onverschuldigd is betaald
fin., tax.recovery of undue paymentterugvordering van het onverschuldigd betaalde
fin.recovery of undue paymentsterugvordering van onverschuldigde betaling
fin.recovery of undue paymentsterugvordering van onverschuldigde bedragen
fin.recovery of unduly paid fundsterugvordering van ten onrechte betaalde gelden
nucl.phys.recovery of uraniumterugwinning van uranium
lawrecovery of various types of contributioninnen van de verschillende premies
patents.recovery of vehiclesberging van voertuigen
environ.recovery of wastenuttige toepassing van afvalstoffen
waste.man.recovery of wastenuttige toepassing
environ.recovery of wastehergebruik van afval
gen.recovery of wrongly levied taxesteruggaaf van onverschuldigd betaalde rechten
chem., mech.eng.recovery oilteruggewonnen olie
fin.recovery operationterugvordering
environ.recovery operationnuttige toepassing
chem.recovery operatoronderneming die stoffen terugwint
chem.recovery operatorterugwinningsbedrijf
chem.recovery operatorfabrikant van een teruggewonnen stof
comp., MSrecovery optionhersteloptie (Any input provided by the administrator during the recovery process, such as the recovery destination, schedule for recovery, and overwrite options)
fin., econ.recovery orderinningsopdracht
comp., MSrecovery passwordherstelwachtwoord (A password (or key) provided by Exchange Server (through OWA) that will be used during the process of resetting the PIN/password of the mobile devices)
hydraul.recovery pegverklikker
industr., construct.recovery percentageconversiefactor
el.recovery period of an automatic gain controlhersteltijd van een automatische versterkingsregeling
pharma., mech.eng.recovery phaseherstel
environ.recovery planherstelplan
environ.recovery plan A formulated or systematic method for the restoration of natural resources or the reuse of materials and objectsherstelplan
environ.recovery planterugwinnings/herstelplan
gen.recovery positionstabiele zijligging
fin.recovery procedureinvorderingsprocedure
fin.recovery procedurevorderingsprocedure
IT, tech.recovery procedureherstelprocedure
fin.recovery procedureprocedure van terugvordering
astronaut., transp.recovery procedureprocedure voor het herstellen
IT, tech.recovery procedurefoutherstelprocedure
chem.recovery processwinningstechniek
chem.recovery processterugwinningsproces
chem.recovery processwinningsmethode
med.recovery rateherstelsnelheid
fin.recovery raterecuperatiepercentage
med.recovery rategenezingssnelheid
med.recovery roomverkoeverkamer
med.recovery roomrecovery
fish.farm.recovery ropekuilstrop
IT, dat.proc.recovery routinefout-onderbrekingsprogramma
hobby, transp.recovery spikelandingsdoorn
transp.recovery suitoverlevingspak
environ.recovery systemterugwinningssysteem
hobby, transp.recovery systembergingssysteem
chem., el.recovery temperaturehersteltemperatuur
earth.sc.recovery temperatureadiabatische evenwichtstemperatuur
chem.recovery testrecovery-test
health.recovery timeherstelperiode
tech.recovery timehersteltijd
meas.inst.recovery timeregelduur
energ.ind.recovery timeterugverdientijd
el.recovery timeherstellingstijd
transp.recovery timekeertijd
transp.recovery timebuffertijd
el.recovery timeomschakeltijd
el.recovery timeinschakel-en hersteltijd
el.recovery timeregeltijd
energ.ind.recovery timeenergieterugbetalingstijd
energ.ind.recovery timeterugbetalingstijd
antenn.recovery timeontionisatietijd m
el.recovery-time circuitschakeling ter bepaling van de omschakeltijd
el.recovery time of diffusion furnacewederopwarmingstijd van een diffusie-oven
gen.recovery valuerecuperatiewaarde
gen.recovery vesseloliebestrijdingsvaartuig
transp., nautic., environ.recovery vesseloliebestrijdingsschip
el.recovery voltagewederkerende spanning
mater.sc., met.reduction of work hardening by recovery annealingvermindering van de koudversteviging bij herstelgloeien
gen.refer to manufacturer/supplier for information on recovery/recyclingraadpleeg fabrikant / leverancier voor informatie over terugwinning / recyclage
gen.refer to manufacturer/supplier for information on recovery/recyclingS59
mech.eng., el.regenerative heat recoveryregeneratieve warmteterugwinning
met.reheating at lower temperature is known as "recovery"door verwarmen tot lagere temperaturen treedt "herstel" op
gen.remote maintainability and recoveryonderhoud en herstel op afstand
fin., transp.request for recoveryverzoek tot invordering
el.reverse recoveryspertraagheid
el.reverse recovery currentstroom ten gevolge van de spertraagheid
el.reverse-recovery-current peakpiekstroom ten gevolge van de spertraagheid
el.reverse-recovery heatingspervertragingsverhitting
el.reverse recovery timespervertragingstijd
lawright of recoveryverhaalsrecht
lawright of recoveryrecht van terugvordering
fin.risk of non-recoveryrisico van niet-innen
insur.salvage and recovery clausebergings-en recuperatieclausule
chem.saturate gas recovery plantverzadigd-gasterugwininstallatie
coal.secondary recoverysecundaire winning
chem.selective recoveryselectieve terugwinning
chem., el.semi-direct sulphate recoverybereiding van ammoniumsulfaat volgens de semi-directe methode
el.short-recovery-time diodediode met korte hersteltijd
econ.signs of economic recoverybegin van economisch herstel
econ.signs of economic recoverytekenen die wijzen op een opleving
el.slow-recovery diodediode met lange hersteltijd
insur.small claims and recoveries pool schemepoolsysteem
insur.small claims and recoveries pool schemehergroeperingssysteem
health.social recoverysociaal herstel
health.social recoverymaatschappelijk herstel
industr., construct.soda recovery boilersodaterugwinningsinstallatie
industr., construct.soda recovery plantafdeling voor sodaterugwinning
industr., construct.soda recovery unitsodaterugwinningsinstallatie
comp., MSsoft recoverysoftwarematig herstel (" "Soft" recovery is what happens when the system is shut down improperly, but you still have the main data files available on the hard drive. The server goes through the logs, and "rolls back" any incomplete transactions, thus restoring the database to a state of integrity.")
environ.solvent recovery Solvent recovery is a widely practised form of recycling where spent solvents are distilled and reused. However, the cheaper solvents are often incinerated or dumped in hazardous waste landfill sitesterugwinning van oplosmiddelen
industr.solvent recoveryterugwinning van oplosmiddelen
transp., avia.spin recoveryuit de tol komen
astronaut., transp.stall recoveryovertrekherstel
earth.sc.steel scrap recoveryterugwinning van staalschroot
el.step-recovery diodestep-recovery diode
el.step-recovery diodesnap-off diode
el.step-recovery-effect harmonic generatorharmonische generator op basis van het step-recovery efect
el.step-recovery-effect pulse delaypulsvertraging van het step-recovery effect
el.step-recovery-effect pulse sharpenerstijgtijdverkleining door het step-recovery effect
el.step-recovery sharpenerstijgtijdverkleining door het step-recovery effect
el.2-step time recoverytijdterugwinning in twee stappen
fish.farm.stock recoveryhet weer op peil brengen van een bestand
fish.farm.stock recoveryhet herstellen van een bestand
law, fin., engl.Stolen Asset Recovery InitiativeStolen Asset Recovery Initiative
agric.straw recoveryrecuperatie van het stro
market.subsequent recovery of export dutiesnavordering van rechten bij uitvoer
market.subsequent recovery of import dutiesnavordering van rechten bij invoer
environ.sulfur recovery plantzwavelzuur/fabriek
gen.tank recovery vehiclebergingstank
gen.Tax Recovery DivisionAfdeling Invorderingszaken
fin.technical recoverytechnisch herstel
earth.sc.temperature recovery factortemperatuurherstelfactor
coal.tertiary recoverytertiaire aard oliewinning
coal.tertiary recoverytertiaire oliewinning
energ.ind., oiltertiary recoverytertiaire aardoliewinning
gen.the recovery and recycling of materialsde terugwinning en het hergebruik van stoffen
gen.the recovery positionstabiele zijligging
earth.sc., construct.theoretical recovery of headtheoretische drukhoogteherstel
mech.eng., el.thermal recovery wheelwarmtewiel
industr., construct., chem.thickness recoveryherstel van produktiedikte
el.time recoveryherstel van de tijdinformatie
commun., ITtime-out recoveryblokkeertijdbesturing
commun.timer recovery proceduretimerherstel
commun.timer recovery statetoestand "timerherstel"
commun., ITtimer recovery statehersteltoestand van de TE
el.timing recoverykloktijdterugwinning
transp.timing with built-in recoveryruime dienstregeling
met.top gas recovery turbinehoogovenexpansieturbine
earth.sc., tech.total pressure recovery factorherstel van totale druk
transp.trailing dredger oil recovery vesselsleephopper/oliebestrijdingsvaartuig
el.transient recovery timeblusspanningtijd
earth.sc., mech.eng.transient recovery timehersteltijd sprongfunctie
el.transient recovery voltagewederkerende overgangsspanning
el.two-step time recoverytijdterugwinning in twee stappen
chem., el.ultimate recovery factorwinningsfactor
UNUnited Nations Programme of Action for African Economic Recovery and DevelopmentVN Actieprogramma voor Economisch Herstel en Ontwikkeling van Afrika
commer.unsold goods recoveryterugkoop van onverkochte goederen
transp., environ.vapour recoverydampterugwinning
chem.vapour recoverydampterugwinningseenheid
environ.vapour recovery systemhercirculatie van gas
environ.vapour recovery system Gas feedback device: while refuelling gasoline vapors are sucked off and led back again into the storage tankhercirculatie van gas
chem.vapour recovery systemdampterugwinning
environ., energ.ind.vapour recovery unitdampterugwinningseenheid
el.voltage recoveryterugkeer van de spanning
gen.waiving of enforced recovery proceduresafzien van dwanginvordering
environ.waste for recoveryvoor nuttige toepassing bestemde afvalstoffen
mech.eng., el.waste heat recoverywarmteterugwinning
environ.waste recoveryterugwinning/hergebruik van afval
waste.man.waste recoverynuttige toepassing
environ.waste recoveryhergebruik van afval
environ.waste recovery The process of obtaining materials or energy resources from wastehergebruik van afval
environ., mech.eng.waste recovery grabgrijpemmer
environ.waste recovery machineuitvalmachine
environ.waste recovery machineafvalverwerkingsmachine
environ.wastes from solvent and coolant recovery still bottomsafval van de terugwinning van oplosmiddelen en koelmiddelen destillatieresiduen
environ.wastes from solvent and coolant recovery still bottomsafval van de terugwinning van oplosmiddelen en koelmiddelendestillatieresiduen
transp.water recoverywaterballastwinning
environ.water recoveryterugwinning van water
comp., MSWindows Diagnosis and RecoveryWindows Diagnose en herstel (A feature in Windows that allows users to run system diagnostics and troubleshooting)
gen.Working Group on Economic Recovery and Development of the Friends of the Syrian PeopleWerkgroep economisch herstel en ontwikkeling van de Vrienden van het Syrische volk
gen.Working Party on Removal and Recovery of Wastes and Residues in the Iron and Steel IndustryWerkgroep Verwijdering en terugwinning van afval in de ijzer- en staalindustrie
fin.Working Party on Unemployment and Economic RecoveryWerkgroep "Werkloosheid en economisch herstel"
met.zinc recoveryterugwinning van zink
Showing first 500 phrases

Get short URL