DictionaryForumContacts

Terms containing Parent | all forms | exact matches only
SubjectEnglishGerman
law, social.sc.abduction by parentKindesentführung durch einen Elternteil
gov., sociol.actual education costs incurred by parentsdie den Eltern durch den Schulbesuch tatsächlich entstehenden Kosten
gen.adoptive parentAdoptivelternteil
gen.adoptive parentAnnehmender
gen.adoptive parentAdoptivelter
tech.airline parent companiesverkehrswirtschaftliche Dachorganisationen
agric.area intended for utilisation of parent vines for root-stockMutterrebenbestände, die als Unterlagsreben verwendet werden
inf.bad parentsRabeneltern
gen.to be managed on a unified basis by the parent undertakingunter einheitlicher Leitung des Mutterunternehmens stehen
gen.biological parentbiologischer Elternteil
gen.biological parentleiblicher Elter
gen.biological parentleiblicher Elternteil
ed.biological parentleiblicher Eltemteil
ed.biological parentbiologischer Eltemteil
gen.biological parentbiologischer Elter
gen.birth parentbiologischer Elternteil
proced.law.birth parent-child relationshipbiologische Abstammung
proced.law.birth parent-child relationshipgenetische Abstammung
proced.law.birth parent-child relationshipleibliche Abstammung
gen.bride's parentsBrauteltern
tech.cadre unit parent unitStammtruppenteil
f.trade.capital is owned for more than 50% by one single parent companyKapitalmehrheit ist im Besitz einer einzigen Muttergesellschaft
gen.child of divorced parentsScheidungswaise
gen.child of divorced parentsScheidungskind
gen.concerned parentsbesorgte Eltern
lawconcertation between the parent companiesVerhaltensabstimmung zwischen den Gründerunternehmen
gen.cruel parentsRabeneltern
med.Cuignet-Parent methodCuignet Methode
med.Cuignet-Parent methodCuignet-Parent Methode
fin.debt - parent companyVerbindlichkeiten gegenüber der Muttergesellschaft
immigr.dependent parentsunterhaltsberechtigte Eltern
health., anim.husb.derivates which readily yield the parent compound on hydrolysis after absorption at the site of applicationDerivate, die bei der Hydrolyse nach der Resorption an der Verabfolgungsstelle leicht die Ausgangsverbindung ergeben
h.rghts.act.Detainees' Parents Support CommitteeKomitee zur Unterstützung von Eltern verhafteter Kinder
fin., account.direct or indirect parent undertakingsdirekte oder indirekte Mutterunternehmen
ed.distant parentFemeltemteil
gen.divorced parentgeschiedener Elternteil
gen.divorced parentgeschiedener Elter
fin.EU parent credit institutionEU-Mutterkreditinstitut
fin.EU parent financial holding companyEU-Mutterfinanzholdinggesellschaft
fin.EU parent institutionEU-Mutterkreditinstitut
fin.EU parent investment firmEU-Mutterwertpapierfirma
fin., busin., labor.org.EU parent mixed financial holding companygemischte EU-Mutterfinanzholdinggesellschaft
social.sc.European Network of single-parent familiesEuropäisches Netzwerk von Alleinerziehenden
social.sc., ed., polit.European Parents' AssociationEuropäische Eltern Organisation
agric.female parentSamenelter
agric.female parentSaatelter
ed.foster parentPflegeelternteil
gen.foster-parentsPflegeeltern
gen.grand parent companyGroßmuttergesellschaft
agric., health., anim.husb.grand parent stockZuchtgeflügel
industr., construct., chem.groove left between the parent material and the side of the deposited materialRandkerbe
gen.He was placed with foster parents.Er kam zu Pflegeeltern.
telecom.higher-parent exchangeübergeordnetes Amt
telecom.higher-parent exchangeMuttervermittlungsstelle
telecom.higher-parent exchangeAmt
gen.homosexual parenthomosexueller Elternteil
gen.homosexual parenthomosexueller Elter
econ.income actually transferred to the parent enterprisetatsächlich an das Mutterunternehmen abgeführte Gewinne
tech.industrial parent companiesindustrielle Dachorganisationen
account.investments of subsidiary in capital stock of parent companykonzerneigene Anteile
met.lack of fusion between parent metal and deposited metaleinbrandfehler
met.lack of fusion between parent metal and deposited metalbindefehler
met.layer of oxide between two runs or between one run and the parent metaloxydschicht
met.layer of oxide between two runs or between one run and the parent metaloxydhaut
met.layer of oxide between two runs or between one run and the parent metaloxydeinschluss
lawlegal child/parent relationshipKindschaftsverhältnis
ed.legal parentjuristischer Elternteil
gen.lone parentalleinerziehender Elter
gen.lone parentAlleinerziehender
social.sc.lone parentalleinerziehender Elternteil
gen.lone parentAlleinerziehende
gen.lone parent familyEinelternfamilie
social.sc.lone parent familyalleinerziehende Mütter und Väter
social.sc.lone parent familyFamilie mit nur einem Elternteil
gen.lone parent familyEin-Eltern-Familie
sec.sys.lone parent's allowanceZulage für alleinerziehende Väter/Mütter
social.sc.lone parent's allowanceBeihilfe für Alleinerziehende
agric.male parentPollenelter
gen.Martensite has a composition identical with that of the parent phaseder Martensit hat die gleiche Zusammensetzung wie die Mutterphase
nucl.phys., radiat.nuclear parentAusgangsnuklid
phys.nuclear parentMutterkern
nucl.phys., radiat.nuclear parentMutternuklid
radiat.nuclear parentMuttersubstanz
sec.sys.one-parent benefitZulage für alleinerziehende Väter/Mütter
fin., social.sc.one-parent benefitAlleinerziehergeld
fin., social.sc.one-parent benefitBeihilfe für Alleinerziehende
gen.one-parent familiesEinelternfamilien
social.sc.one-parent familyFamilie mit nur einem Elternteil
social.sc.one parent familyFamilie mit nur einem Elternteil
social.sc.one parent familyEinelternfamilie
social.sc.one parent familyalleinerziehende Mütter und Väter
econ.one-parent familyFamilie mit einem Elternteil
social.sc.one-parent familyalleinerziehender Elternteil
social.sc.one-parent familyEinelternfamilie
health.one-parent progeny testEinzelbaum-Nachkommenschaftstest
insur., social.sc.orphan pension of a child whose one parent is aliveHalbwaisenrente
social.sc.orphan who has lost both parentsVollwaise
gen.paid leave for new parentErziehungsurlaub
commun.pamphlets for parentsbspw. Aufklaerungsschriften
commun.pamphlets for parentsBroschueren fuer die Eltern
comp., MSparent accountübergeordnete Firma (An account that is above other accounts in the hierarchy to which any action taken on the main account entity can propagate to)
gen.parent actErmächtigungsgrundlage
econ.parent applicationStammanmeldung (eines Patents)
gen.parent atomMutternuklid
gen.parent atomMutterkern
chem.parent atomAusgangsatom
phys.parent atomMutteratom
gen.parent atomAusgangskern
fin.parent bankMutterbank
econ.parent bankStammbank
coal., met.parent blendBesatzkohle
coal., met.parent blendEinsatzkohle
coal., met.parent blendKokskohle
law, ADRparent bodyStammorgan
agric.parent branchMutterast
gen.parent bug Elasmucha griseaFleckige Brutwanze
horticult.parent bulbMutterzwiebel
comp., MSparent businessübergeordnetes Unternehmen (A business in which any action taken on the main business can propagate to the subordinate business)
comp., MSparent business unitübergeordnete Geschäftseinheit (A business unit that is immediately above another business unit in the business hierarchy of an organization)
comp., MSparent cache serverübergeordneter Cacheserver (In a multi-tiered cache hierarchy, a disk-based cache proxy/server that sits between the edge cache node and the origin server)
construct.parent canalZuflusskanal
transp.parent carrierMutterluftfahrtunternehmen
comp., MSparent categoryübergeordnete Kategorie (An entity used in catalogs to group a set of products in a hierarchy. For example Music is a parent category and Rock Jazz and Classical are child categories)
med.parent cellStammzelle
med.parent cellMutterzelle
med.parent cellElternzelle
gen.parent cellsElternzellen
tech.parent channelHauptkanal
comp., MSParent: Child Business UnitsÜbergeordnet: Untergeordnete Unternehmenseinheiten (A security access level that allows a user access to record types in the user's business unit and all business units subordinate to the user's business unit)
proced.law.parent-child relationshipKindschaftsverhältnis
proced.law.parent-child relationshipEltern-Kind-Verhältnis
proced.law.parent-child relationshipAbstammung
gen.parent-child relationshipEltern-Kind-Beziehung
law, social.sc.parent claiming right of accessumgangsberechtigter Elternteil
AI.parent clauseElternklausel
life.sc.parent cloudMutterwolke
beekeep.parent colonyStammvolk (of swarm)
beekeep.parent colonyMuttervolk (of swarm)
astr.parent cometUrsprungskomet
tax.parent companies with common tax systemMuttergesellschaften mit einem gemeinsamem Steuersystem
comp., MSparent companyMuttergesellschaft (A company that owns more than one separate subsidiary)
lawparent companyGründerunternehmen
lawparent companyDachgesellschaft
gen.parent companyMuttergesellschaft
lawparent companyObergesellschaft
lawparent companyMutterunternehmen
fin.parent companyMutteresellschaft
fin., busin., labor.org.parent companyMutterinstitut
fin.parent companyHolding
econ.parent companyKonzernmutter (makhno)
lawparent companyStammhaus
gen.parent companyOrganträger
gen.parent companyMutterfirma
gen.parent companyherrschende Gesellschaft
f.trade.parent company and subsidiary companiesMuttergesellschaft und verschiedene Tochtergesellschaften
fin.parent company theoryInteressenstheorie
gen.parent compoundAusgangsverbindung
health.parent compoundBestandteil
chem.parent compoundGrundkörper (Strukturformel)
gen.parent conference dayElternsprechtag
comp., MSparent content type templateübergeordnete Inhaltstypvorlage (A type of content that exists prior to the association with an actual Windows SharePoint Services list. This distinction is made since items cannot use a type until it is associated with a WSS list)
IMF.parent corporationMuttergesellschaft
social.sc.parent counsellingElternberatung
fin.parent credit institutionMutterkreditinstitut
fin.parent credit institution in a Member StateMutterkreditinstitut in einem Mitgliedstaat
comp., MSparent customerübergeordneter Kunde (An account that is immediately above a contact entity. Any action taken on the account entity can propagate to the child contact entity)
comp.parent directoryübergeordnetes Verzeichnis
comp.parent directoryStammverzeichnis
comp., MSparent domainübergeordnete Domäne (For DNS and Active Directory, domains that are located in the namespace tree directly above other derivative domain names (child domains))
med.parent drugMuttersubstanz
ed.parent educationSchulung von Eltern
phys.parent elementMutterelement
comp., MSparent elementübergeordnetes Element (In a tree structure, an element that contains subordinate elements called child elements)
chem.parent elementAusgangselement
transp., industr.parent engineStammotor
IMF.parent enterpriseMuttergesellschaft
econ.parent enterpriseDachgesellschaft
commun.parent exchangeHauptvermittlung
el.parent exchangeHauptvermittlungsstelle
el.parent exchangeHauptrechner
commun.parent exchangeMutteramt
tech.parent exchangeHauptamt
tech.parent fieldursprüngliches Feld
IT, dat.proc.parent fileElterndatei
fin.parent financial holding company in a Member StateMutterfinanzholdinggesellschaft in einem Mitgliedstaat
gen.parent firmStammhaus
life.sc.parent fluidprimäres Fluidium
biol.parent food organismals Nahrung dienender/genutzter Elternorganismus
biol.parent food organismals Lebensmittel genutzter Elternorganismus
chem.parent formUrform
chem.parent formStammform
tech.parent frequenciesPrimaerfrequenzen
industr., construct., met.parent glassGrundglas
industr., construct., met.parent glassMutterglas
industr., construct., met.parent glassStammglas
agric.parent groundErd-
agric.parent groundGrund-
agric.parent groundBoden-
social.sc.parent guidanceElternberatung
gen.parent headquartersStammhauptquartier
mining.parent holeBohrloch, von dem ein anderes abzweigt
comp., MSparent host groupübergeordnete Hostgruppe (" A host group that contains another host group, which is known as a "child host group.")
gen.parent houseStammhaus
gen.parent HQStammhauptquartier
gen.parent-in-lawSchwiegerelternteil
gen.parent institution of an officialStammorgan eines Beamten
fin.parent investment firm in a Member StateMutterwertpapierfirma in einem Mitgliedstaat
anal.chem.parent ionMutterion
chem.parent ionElternion
chem.parent ionAusgangsion (MS)
tech.parent isotopeAusgangsisotope
tech.parent isotopeMutterisotope
chem.parent isotopeMutterisotop
radiat.parent isotopeAusgangsisotop
comp., MSparent keywordübergeordnetes Stichwort (A keyword that is associated with one or more subordinate keywords)
tech.parent latticeHauptgitter
opt.parent lineMutterlinie
opt.parent linereelle Linie
met.parent al magmaMuttermagma
chem.parent materialAusgangsstoff
construct.parent materialGrundmaterial (Schweißen)
nat.res., agric.parent materialElternmaterial
industr., construct., chem.parent materialGrundwerkstoff
life.sc., agric., el.parent materialUrsprungsmaterial
life.sc., agric.parent materialAusgangsmaterial
construct.parent materialAusgangsgestein (Erdstoff)
nat.res.parent materialAusgangsgestein
nat.res.parent materialbodenbildendes Gestein
nat.res.parent materialMuttergestein
nat.res.parent materialbodenbildendes Material
nat.res.parent materialAusgangssubstrat
tech.parent materialUrstoff
met.parent metalBasismetall
tech.parent metalGrundwerkstoff
tech.parent metalGrundmetall
construct.parent metalGrundmetall (Schweißen)
met.parent metal test specimenprobe aus dem grundwerkstoff
fin., busin., labor.org.parent mixed financial holding company in a Member Stategemischte Mutterfinanzholdinggesellschaft in einem Mitgliedstaat
anal.chem.parent molecular peakMolekülpeak
astr.parent-moleculeMuttermolekül
chem.parent moleculeGrundkörper (Strukturformel, backbone)
chem.parent nameStammname
AI.parent nodeVorgängerknoten
comp., MSparent nodeübergeordneter Knoten (A node with subordinate node(s), called children)
AI.parent nodeElternknoten
law, social.sc.parent not having custody of the childnicht sorgeberechtigter Elternteil
law, social.sc.parent not having custody of the childElter ohne Sorgerecht
radiat.parent nucleusMutterkern
gen.parent nucleusMutternuklid
gen.parent nucleusAusgangskern
phys.sc.parent nuclideAusgangsnuklid
tech.parent nuclideMutternuklid
radiat.parent nuclideMuttersubstanz
comp., MSparent objectübergeordnetes Objekt (The object in which another object resides. A parent object implies relation. For example, a folder is a parent object in which a file, or child object, resides. An object can be both a parent and a child object. For example, a subfolder that contains files is both the child of the parent folder and the parent folder of the files)
commun.parent officevorgesetztes Postamt
commun.parent officezuständiges Postamt
commun., ITparent operationMutterfunktion
commun., ITparent operationMutteroperation
commun., ITparent operationHauptprozeß
NGOparent or legal guardianErziehungsberechtigte
austrianparent or legal guardianErziehungsberechtigter
life.sc., industr.parent organismElternorganismus
gen.parent organizationDachorganisation
lawparent organizationMuttergesellschaft
SAP.fin.parent pageübergeordnete Seite (You-She)
tech.parent partBasisbauteil
tech.parent partGrundkörper
tech.parent partAusgangsteil
comp., MSparent partitionübergeordnete Partition (The partition that manages the virtual machines)
tech.parent patentStammpatent
tech.parent peakBezugsmaximum im Massenspektrogramm
met.parent phaseMutterphase
comp., MSparent picklistübergeordnete Auswahlliste (A drop-down list control that determines the values of another drop-down list (also known as a picklist) or a check box)
med.parent plantAusgangspflanze
life.sc., agric.parent plantMutterpflanze
tech.parent plantStammwerk
med.parent plantStammpflanze
tech.parent plus daughter fractionMutter- u. Tochteranteil
gen.parent populationGrundgesamtheit
econ.parent populationAusgangsgesamtheit
tech.parent populationurspruengliche Grundgesamtheit
comp., MSparent projectübergeordnetes Projekt (A project that has one or more subprojects)
radiat.parent radioactive isotoperadioaktives Ausgangsisotop
radiat.parent radioactive isotoperadioaktives Mutterisotop
nucl.phys., radiat.parent radioisotoperadioaktives Mutterisotop
radiat.parent radioisotoperadioaktives Ausgangsisotop
phys.sc.parent radionuclideAusgangsnuklid
comp., MSparent recordübergeordneter Datensatz (The highest-level container of one or more work items that includes new and changed configuration items)
industr.parent reelMutterrolle
law, social.sc.parent required to grant right of accessElternteil, der das Umgangsrecht einzuräumen hat
geol.parent rockMutterholzart
nat.res.parent rockAusgangsmaterial
gen.parent rockMuttergestein
found.engin.parent rockMutterboden
found.engin.parent rockFestland
earth.sc., mining., oilparent rockUrsprungsgestein
nat.res.parent rockAusgangssubstrat
nat.res.parent rockbodenbildendes Material
nat.res.parent rockbodenbildendes Gestein
gen.parent rockAusgangsgestein
soil.parent-rock mineralbodenbildendes Mineral
agric.parent rootWurzelstock
gen.parent shipMutterschiff (einer Flotte oder eines Schiffsverbandes)
comp., MSparent siteübergeordneter Standort (A site that has one or more child sites)
comp., MSparent solutionübergeordnete Lösung (A solution to which a component belongs to. A component can have only one parent solution)
gen.parent solutionStammlösung
med.parent solutionVorratslösung
tech.parent specificationHauptpatent
agric.parent standSamenerntebestand
agric.parent standMutterbestand
radioparent stationMuttersender
agric.parent stockElterntiere
agric., health., anim.husb.parent stock birdsVermehrungsgeflügel
agric.parent stock chickVermehrungskueken
agric., health., anim.husb.parent stock chicksVermehrungsküken
econ.parent storeStammhaus
econ.parent storeStammgeschäft
econ.parent storeHauptgeschäft (mit mehreren Filialen)
gen.Parent Subsidiary DirectiveMutter-/Tochter-Richtlinie
law, ADRparent-subsidiary relationshipMutter-Tochtergesellschaft
lawparent-subsidiary relationshipVerhältnis der Über-und Unterordnung
chem.parent substanceGrundkörper
tech.parent substanceAusgangsmaterial
chem.parent substanceMutterstoff
gen.parent substanceMuttersubstanz
chem.parent substanceStammkörper
commun.parent switching centerHauptvermittlunsgsstelle
commun.parent switching centreHauptvermittlunsgsstelle
comp., MSparent tableübergeordnete Tabelle (A table that assumes a parent role when it participates in an integrity relationship with another table and whose attribute values migrate to foreign key attributes in the table assuming the child role in the relationship)
IT, dat.proc.parent taskHaupttask
gen.parent-teacher association PTALehrer-Eltern-Ausschuss
gen.parent-teacher associationLehrer- und Elternverband
tech.parent tractionAnteil der Muttersubstanz
TVparent transmitterGrundnetzsender
forestr.parent-treeOberständer
forestr.parent-treeÜberhälter
forestr., horticult.parent treeMutterbaum
ITparent typeVatertyp
fin., busin., labor.org.parent undertakingMutterinstitut
gen.parent undertakingMutterunternehmen
law, econ., busin.parent undertakingMuttergesellschaft
gen.parent undertakingherrschende Gesellschaft
gen.parent vehicleStammfahrzeug
agric.parent vine for root-stockMutterrebenbestand für die Erzeugung von Unterlagen
agric.parent vine for root-stockRebschnittgärten für Unterlagen
agric.parent vine for root-stockUnterlagenschnittgärten
agric.parent vine for root-stockals Unterlagsreben dienende Mutterreben
comp., MSparent Webübergeordnetes Web (In a hierarchical structure, the Web site that contains the active site)
comp., MSparent Web siteübergeordnete Website (In a hierarchical structure, the Web site that contains the active site)
health., life.sc., agric.parent wild strainsursprüngliche Wildstämme
tech.parent windowHauptfenster
comp., MSparent windowübergeordnetes Fenster (A primary window that provides window management for a set of child windows. See also child window and multiple-document interface)
law, social.sc.parent with custodysorgeberechtigter Elternteil
law, social.sc.parent with right of accessumgangsberechtigter Elternteil
comp., MSparent workflowübergeordneter Workflow (A workflow that starts a child workflow. The child workflow communicates its outcome back to the parent workflow)
ed.Parents'AssociationElternvereinigung
ed.Parents'AssociationElternbeirat
lab.law.parents'authorityelterliches Sorgerecht
gen.parents' bedroomElternschlafzimmer
gen.parents by adoptionAdoptiveltern
NGOparents' contributionsElternbeiträge
gen.parents' councilElternbeirat
gen.parents' eveningElternabend (Schulwesen)
gen.parents' houseElternhaus
gen.parents in lawSchwiegereltern
commun., social.sc.parents magazineElternmagazin
insur., social.sc.pension of an orphan who has lost both parentsVollwaisenrente
nat.sc.plant of the female parentweibliche Elternpflanze
agric.pollen parentPollenelter
comp., MSprimary parent categoryprimäre übergeordnete Kategorie (The parent category of a product or category that is used to determine the canonical path to that product or category, or to apply category level pricing rules to the category or product)
lawprivilege of parent companies and subsidiariesSchachtelprivileg
met.protective coating prevents corrosion of the parent metalder Schutzuberzug verhuetet die Korrosion des Grundwerkstoffs
ed.psychological parentpsychologischer Eltemteil
gen.psychological parentBezugsperson
social.sc.psycho-social dysfunctioning in the child-parent relationshippychosoziale Störung des Eltern-Kind-Verhältnisses
nucl.phys., radiat.radioactive parentMutternuklid (head of a radioactive series)
radiat.radioactive parentMuttersubstanz (head of a radioactive series)
fin.receivables - parent companyForderungen gegen Muttergesellschaft
med.recurrent parentRückkreuzungselter
NGOreduced parents' contributionErmäßigung der Elternbeiträge
lawrights and duties between parents and childrenAnsprüche und Verpflichtungen zwischen Eltern und Kindern
proced.law.rights and duties of parentsRechte und Pflichten der Eltern
proced.law.rights and duties of parentsElternrechte und -pflichten
proced.law.rights and obligations of parentsElternrechte und -pflichten
proced.law.rights and obligations of parentsRechte und Pflichten der Eltern
agric.root-stock parent vineRebschnittgärten für Unterlagen
agric.root-stock parent vineUnterlagenschnittgärten
agric.root-stock parent vineMutterrebenbestand für die Erzeugung von Unterlagen
agric.root-stock parent vineals Unterlagsreben dienende Mutterreben
gen.same-sex parent familyhomosexuelle Familie
obs.same-sex parent familyHomo-Familie
gen.same-sex parent familyRegenbogenfamilie
agric.seed parentSaatelter
agric.seed parentSamenelter
obs.separated parentgetrennt lebender Elternteil
gen.separated parentvom anderen Elternteil getrennt lebender Elternteil
social.sc.single parentAlleinerziehender
econ.single parentunverheirateter Elternteil
social.sc.single parentalleinerziehender Elternteil
gen.single parentAlleinerziehende
stat., social.sc.single-parent familiesAlleinerziehende
stat., social.sc.single parent familiesAlleinerziehende
social.sc.single parent familyalleinerziehender Elternteil
social.sc.single parent familyalleinerziehende Mütter und Väter
social.sc.single parent familyFamilie mit nur einem Elternteil
gen.single parent familyRumpffamilie
gen.single parent familyEin-Eltern-Familie
gen.single parent familyEinelternfamilie
gen.single parentsAlleinerzieher
gen.single parentsAlleinerziehende
ed.social parentsozialer Elternteil
proced.law.sole adoptive parentN/A DE
law, fin.special arrangements applicable to parent companies and their subsidiariesbesondere steuerliche Behandlung von Mutter-und Tochtergesellschaften
NGOspouse or parent who has taken up residence in Austria and is subsequently joined by other family memberZusammenführender (ehem. Ankerfremder)
austrianspouse or parent who has taken up residence in Austria and is subsequently joined by other family membersZusammenführender (ehem. Ankerfremder)
gen.stay with parentsbei seinen Eltern leben
gen.step-parentStiefelternteil
gen.step-parentStiefelter
proced.law.step-parent adoptionStiefkindadoption
gen.step-parentsStiefeltern
ed.sufficiently good parentausreichend guter Eltemteil
law, social.sc.surrogate parentErsatzelternteil
ed., social.sc.Swiss Association of Parent EducationSchweizerischer Bund für Elternbildung
ed., social.sc.Swiss Association of Parent EducationSBE
health.Swiss Association of parents of children with epilepsySchweizerische Vereinigung der Eltern epilepsiekranker Kinder
health.Swiss Association of parents of children with epilepsySVEEK
health.Swiss Association of parents of children with epilepsyPar Epi
fin., tax.tax treatment of parent and subsidiary companiessteuerliche Behandlung der Mutter- und Tochtergesellschaften
gen.teen parentsTeenieeltern (Eltern im Teenageralter)
inf.teen parentsTeenie-Eltern ugs. : Eltern im Teenageralter
inf.teen parentsTeenieeltern ugs. : Eltern im Teenageralter
gen.teen parentsTeenie-Eltern (Eltern im Teenageralter)
gen.teens' parentsTeenie-Eltern (Eltern von Teenagern)
inf.teens' parentsTeenie-Eltern ugs. : Eltern von Teenagern
gen.teens' parentsTeenieeltern (Eltern von Teenagern)
gen.teenyboppers' parentsTeenie-Eltern (Eltern von jungen Teenagern, bes. Mädchen)
amer.teenyboppers' parentsTeenie-Eltern ugs. : Eltern von jungen Teenagern, bes. Mädchen
gen.teenyboppers' parentsTeenieeltern (Eltern von jungen Teenagern, bes. Mädchen)
beekeep.to hive a swarm to the parent colonyin den alten Stock zurückkehren
gen.to parentjdn. erziehen (smb.)
gen.to parentjdn. betreuen (smb.)
gen.to parentjdn. aufziehen (smb.)
social.sc.two-parent familyFamilie mit zwei Elternteilen
nat.res.two-parent progeny testNachkommenschaftsprüfung nach kontrollierter Bestäubung
tax.ultimate parentoberste Muttergesellschaft
tax.ultimate parent companyoberste Muttergesellschaft
gen.uncaring parentsRabeneltern
busin., labor.org.undertaking which is the parent of the undertakings to be consolidatedUnternehmen, das an der Spitze der zu konsolidierenden Unternehmen steht
fin.Union parent financial holding companyEU-Mutterfinanzholdinggesellschaft
fin., busin., labor.org.Union parent mixed financial holding companygemischte EU-Mutterfinanzholdinggesellschaft
proced.law.unknown parentsunbekannte Eltern
gen.unmarried parentlediger Elternteil
gen.unmarried parentlediger Elter
gen.unnatural parentsRabeneltern
met.weld where the parent metal has softened allowing the weld and edges of metal to sagdurchgesackte Naht
met.weld where the parent metal has softened allowing the weld and edges of metal to sagdurchgefallene Naht

Get short URL